KEGG   Polynucleobacter necessarius: Pnec_0561Help
Entry
Pnec_0561         CDS       T00683                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pne  Polynucleobacter necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3305
Motif
Other DBs
NCBI-ProteinID: ACB43818
UniProt: B1XTZ1
Position
497777..497944
Genome map
AA seq 55 aa AA seqDB search
MRKQNIDNPWVSYRWVPQEVLPDFGQFNSKQSNFIAGQFLGRDADGESWLLRVMS
NT seq 168 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagcaaaatattgacaacccatgggtttcataccgttgggttcctcaagaggtg
ttgccagattttgggcaatttaatagcaaacaaagcaatttcattgcaggtcagtttctt
ggacgtgatgctgatggtgaatcttggcttttgcgggttatgagctag

DBGET integrated database retrieval system