KEGG   Polynucleobacter necessarius: Pnec_0564Help
Entry
Pnec_0564         CDS       T00683                                 

Definition
(GenBank) 4Fe-4S ferredoxin iron-sulfur binding domain protein
  KO
K00124  formate dehydrogenase iron-sulfur subunit
Organism
pne  Polynucleobacter necessarius
Pathway
pne00630  Glyoxylate and dicarboxylate metabolism
pne00680  Methane metabolism
pne01100  Metabolic pathways
pne01120  Microbial metabolism in diverse environments
pne01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Pnec_0564
  09102 Energy metabolism
   00680 Methane metabolism
    Pnec_0564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_11 Fer4_7 Fer4 Fer4_9 Fer4_6 Fer4_2 Fer4_10 Fer4_21 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ACB43821
UniProt: B1XTZ4
Position
498626..499384
Genome map
AA seq 252 aa AA seqDB search
MLERIAQSDMLNLFSKATEVAQEGVKDAAQAVDLPFEASKLEAQQQTDLTSTDQKLSARL
DEVPWGVNRRRVVTVHDGIIGQEKSVSVACMHCSDAPCMAVCPVDCFYRTDEGVVLHDKD
ICIGCGYCSFACPFGAPQFLSKGAFGSCSKMDKCTFCSGGPEENGSVAEFEEYGRNRLAE
GKLPLCAEMCSTKTLIGGDSNIISGIFNNRVATREKNGKYPGSKAFGWTTAYGGPDTPAP
TPTPAAKIPGAK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgctcgagcgaatagcgcagagcgatatgttgaatctattcagtaaggcgactgaagtg
gctcaagagggtgtaaaagatgcggcccaagccgtcgatctaccgtttgaagctagtaaa
ttagaggcacaacagcaaactgatttaacatccacagaccaaaaactctccgctcggtta
gatgaagtgccttggggtgttaaccgtcgtcgtgttgtaacggtgcatgacggcattatt
ggtcaagaaaaatcagtttcagttgcttgtatgcactgtagcgatgcaccttgtatggcg
gtatgtccggttgattgcttctatcgcacggacgaaggcgttgtgttgcacgataaagat
atctgtatcggttgcggctactgctcttttgcttgcccatttggtgcgcctcagttcttg
agcaagggtgccttcggttcctgcagcaagatggataagtgcacattctgtagtggtggc
ccagaagaaaacggcagtgttgctgaatttgaggagtatggacgcaatcgcttggcagaa
ggcaagttgccgctctgtgccgaaatgtgctctaccaaaaccttaattggtggcgatagc
aatattatttctggcatcttcaataatcgcgttgctactcgcgagaagaatggtaagtac
ccaggatccaaagcctttggttggactactgcgtatggtggcccagatactccagcgcca
acaccaacacctgctgcaaaaatcccaggagctaaataa

DBGET integrated database retrieval system