KEGG   Polynucleobacter necessarius: Pnec_0566Help
Entry
Pnec_0566         CDS       T00683                                 

Definition
(GenBank) formate dehydrogenase, gamma subunit
  KO
K00127  formate dehydrogenase subunit gamma
Organism
pne  Polynucleobacter necessarius
Pathway
pne00630  Glyoxylate and dicarboxylate metabolism
pne00680  Methane metabolism
pne01100  Metabolic pathways
pne01120  Microbial metabolism in diverse environments
pne01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Pnec_0566
  09102 Energy metabolism
   00680 Methane metabolism
    Pnec_0566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ni_hydr_CYTB CTF_NFI
Motif
Other DBs
NCBI-ProteinID: ACB43823
UniProt: B1XTZ6
Position
499668..500186
Genome map
AA seq 172 aa AA seqDB search
MKRSFSKVLRTLVVAASLSLTLASGISFAERAPMAPLPSPSGVDVSPLSVPANPSALANG
TQAQAQPANPSIFTSANSDPYNYVSIPDKEASVLIQRSGQQWRVIRNGVITVFGDWLLAL
AFFGIIATYTLKGPMKLHEPMSGVKIKRFSAFDRLVHWLMAFSFLALAFTGQ
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgatcattttctaaagttctacgcactttggtagtggctgctagtttgtcgctg
actttggcaagtgggatcagttttgctgagcgcgcgccgatggcgccacttccgtcaccg
agcggggtggatgtttcacctttgtcagtgccagcaaatcccagtgccttggcaaatgga
actcaagcgcaggctcagccagcaaacccatcgatttttacttccgcgaatagcgatccc
tataactatgtcagcattccagacaaagaagctagcgttttaattcagcgctctggtcaa
cagtggcgtgtgattcgtaatggtgtgatcactgtgttcggcgattggttgctcgcattg
gcatttttcgggattattgcaacctacacgctcaaaggccctatgaagttacatgagcca
atgtctggtgtaaagattaagcgcttcagtgcctttgatcgcctagttcactggttgatg
gcatttagctttttagcattggctttcactggccagtag

DBGET integrated database retrieval system