KEGG   Polynucleobacter necessarius: Pnec_0573Help
Entry
Pnec_0573         CDS       T00683                                 

Definition
(GenBank) acyl-CoA dehydrogenase domain protein
  KO
K00249  acyl-CoA dehydrogenase [EC:1.3.8.7]
Organism
pne  Polynucleobacter necessarius
Pathway
pne00071  Fatty acid degradation
pne00280  Valine, leucine and isoleucine degradation
pne00410  beta-Alanine metabolism
pne00640  Propanoate metabolism
pne01100  Metabolic pathways
pne01110  Biosynthesis of secondary metabolites
pne01130  Biosynthesis of antibiotics
pne01200  Carbon metabolism
pne01212  Fatty acid metabolism
Module
pne_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Pnec_0573
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Pnec_0573
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pnec_0573
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pnec_0573
Enzymes [BR:pne01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.7  medium-chain acyl-CoA dehydrogenase
     Pnec_0573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_N
Motif
Other DBs
NCBI-ProteinID: ACB43830
UniProt: B1XU03
Position
complement(504556..504906)
Genome map
AA seq 116 aa AA seqDB search
MNHPIPKPDQYQEMREALRDLCGSFDSAYWQKIDHERAYPEAFVDAMTKAGWLAAFIPEE
YGGSGLGLAETSVIMEEINFSGGNSGSCHGQMYNMGTLLRHGSEAQKNYRHSRNTE
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaccctattcctaagccagaccaatatcaagaaatgcgcgaagcattgcgtgac
ctctgcggctcatttgactcagcctactggcaaaagattgaccatgagcgtgcttatcca
gaagcttttgttgatgcaatgactaaagcaggttggttggctgctttcatcccagaggaa
tatggtggctccggtttaggtcttgctgaaacttcagtcatcatggaggaaatcaatttt
tcaggtggcaactcaggctcatgccatgggcagatgtacaacatgggcactttattgcgt
cacggctcagaagctcagaaaaattacaggcactccagaaacaccgagtaa

DBGET integrated database retrieval system