KEGG   Polynucleobacter necessarius: Pnec_0574Help
Entry
Pnec_0574         CDS       T00683                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pne  Polynucleobacter necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNARE_assoc
Motif
Other DBs
NCBI-ProteinID: ACB43831
UniProt: B1XU04
Position
505109..505612
Genome map
AA seq 167 aa AA seqDB search
MEHMFEHFFAWFGMPSVGLPAVFISAFISATLIPAGSEPILFGYISINPHLFWVAIMVAT
VGNTLGGMVDWWLGVIARNSFKSMDEPSDSRLKRWLENWGPKLLLLSWLPGFGDPLCLAA
GWLKLPWQPCLIYMFIGKLLRFIMFTWLLTLVPDSFWHQLGHWLHII
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggagcacatgttcgaacatttttttgcttggtttggaatgccgtctgtcggattgccg
gccgtatttatcagtgccttcatctctgctaccttaataccggcaggctcagagccaatt
ctatttggctacatttctattaatccacacttattttgggttgccattatggtcgccacg
gttggcaatacattgggtggaatggttgactggtggcttggggttatcgcgcgcaatagt
tttaagtcaatggatgagccaagcgatagtcgccttaagcgttggcttgaaaattggggt
cccaaattattgctgttgtcatggctacctggatttggcgatcctttgtgcttggcagcg
ggttggttgaagctgccttggcaaccatgcctcatctacatgtttattggcaagctcctg
cgcttcattatgtttacctggctcctaactttggtgccagacagtttttggcatcagctg
ggccactggcttcatatcatctaa

DBGET integrated database retrieval system