KEGG   Polynucleobacter necessarius: Pnec_0579Help
Entry
Pnec_0579         CDS       T00683                                 

Definition
(GenBank) hypothetical protein
Organism
pne  Polynucleobacter necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Monooxygenase_B
Motif
Other DBs
NCBI-ProteinID: ACB43836
UniProt: B1XU09
Position
complement(508801..509010)
Genome map
AA seq 69 aa AA seqDB search
MKPLSKKAKMTIGWTVLMTVVGTAMLHQWQFFAMDCASLVLLLVANHYDLLKDPEDKKII
PPTKTGLFT
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atgaagccactctctaaaaaagccaagatgaccataggctggacagtcttgatgactgtg
gtgggtaccgctatgttgcaccagtggcagttttttgccatggactgtgcatcactagtc
ctgctgcttgttgcgaaccactacgatctcttaaaagatcccgaagacaaaaaaataatc
ccgcctactaagacaggattattcacttaa

DBGET integrated database retrieval system