KEGG   Polynucleobacter necessarius: Pnec_0580Help
Entry
Pnec_0580         CDS       T00683                                 

Definition
(GenBank) cytochrome b561
  KO
K12262  cytochrome b561
Organism
pne  Polynucleobacter necessarius
Brite
KEGG Orthology (KO) [BR:pne00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    Pnec_0580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ni_hydr_CYTB
Motif
Other DBs
NCBI-ProteinID: ACB43837
UniProt: B1XU10
Position
complement(509007..509309)
Genome map
AA seq 100 aa AA seqDB search
MHWLLYTLLLVSPIFGILYFQYGGKEIHFFGLVWPQLVTPNPEMKKTVEGIHKFLGNSLY
FLIAIHALAGLWQHYVLKDDTLRRMLNKVNAQTEAGAKIK
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgcattggttgctttacactctgcttttggtatcacctatctttggcatcctgtatttt
cagtatggcggcaaagaaatccacttcttcggcttagtatggcctcagctagttacaccc
aatccagaaatgaagaaaacagttgaagggatccataagtttcttggaaactcgctctat
ttcttgatcgccattcatgccttggcaggtttatggcaacattacgtcctaaaggacgat
acacttcgtcgaatgttaaataaggtgaatgcccaaactgaagctggagcgaagattaaa
tga

DBGET integrated database retrieval system