KEGG   Polynucleobacter necessarius: Pnec_0585Help
Entry
Pnec_0585         CDS       T00683                                 

Definition
(GenBank) carbohydrate kinase, YjeF related protein
Organism
pne  Polynucleobacter necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carb_kinase Phos_pyr_kin GT87
Motif
Other DBs
NCBI-ProteinID: ACB43842
UniProt: B1XU15
Position
complement(511602..512486)
Genome map
AA seq 294 aa AA seqDB search
MISPPATLDALKLAKLLKRLPTEHKGNAGKVVLTGGAPGMAGALILAGNACLHLGAGWTI
LEMLDPSSARAAVDYPELMIRLATENIQENLVNTQADVIAVGPGLGNSDLAQLCLNASLS
FPNIPLVIDADALNLISNSAKLLEQLQIRNQQFPRLTVLTPHPGEAAKLLKTSTENVQAN
RLSAIQQLVQLTQSIVVLKGEHTLIASPQHPPMQCLAGNPGMGTGGMGDVLTGSIAAIAG
QGVRHHLDLWQATSIAVELHASAADSLVSKGIGPIGLTPSETILEMRALLNKLL
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgatctccccacccgccaccctcgatgcgctgaagttagccaagctactaaagcgccta
cctacagagcataaaggtaatgcaggtaaagttgttttaacgggcggcgcacccggcatg
gcaggcgccctcattttggcaggcaatgcctgcttgcatctaggcgcaggatggaccatc
ctagaaatgctagacccaagctcggcaagggctgctgttgattatcccgaactcatgatc
cgtcttgcgacagaaaatattcaagaaaacctcgttaatactcaagctgatgtcattgcg
gttggtccaggtcttggtaactctgatttagcacaactctgcctaaatgcatcactctca
ttcccaaatattccactagtaattgatgctgacgccctcaatctcattagcaactcagcg
aaattgttggagcaactacagattcgcaatcagcagtttcctaggcttactgtcctcacc
ccccatcccggagaggcggctaaactcctcaaaacctcaacagaaaatgtacaagcaaat
cgcctaagcgctattcaacaattagttcaattaacacaatcaatcgtagttcttaaaggc
gaacacactcttatcgcatccccacaacatcccccaatgcaatgccttgctggcaacccc
ggcatgggaacaggaggcatgggagatgttttgaccggcagcattgcagccattgctggc
caaggggttcgtcaccatctagacctctggcaagccactagtattgccgttgagctccat
gctagtgcagcagatagcctggtcagcaaaggtattggccctataggacttacaccttca
gagactatattagagatgcgagccttgctaaataagctgttataa

DBGET integrated database retrieval system