KEGG   Polynucleobacter necessarius: Pnec_0596Help
Entry
Pnec_0596         CDS       T00683                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pne  Polynucleobacter necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phasin_2 ApoLp-III Fib_alpha Snapin_Pallidin Apolipoprotein Pneumo_M2 Peptidase_S46
Motif
Other DBs
NCBI-ProteinID: ACB43850
UniProt: B1XU23
Position
519343..519858
Genome map
AA seq 171 aa AA seqDB search
MDAKDLQKWQQEKAKELFDYSHKLLDAAKQLSEYHIAEMEWGMKNALDSAKSAAKNDLAK
LKGLQEEAAKEAVKRAAVYQKKVKSVLKDIGEGAADETEKHLEKVRSSLVSWLEDAENKI
PSHTDKLLKVVNEMSSTGQKMFKEGRRIVNQVADAAEKNIDDLVKKSGGKK
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggacgcaaaagatctgcaaaagtggcaacaagagaaagctaaagaactttttgattat
tcgcacaagctattagacgctgccaaacaactgagtgagtaccatattgctgaaatggag
tggggcatgaaaaatgctcttgatagcgctaagtcagcagccaaaaatgatttggcaaaa
ttaaaaggcttgcaagaagaggctgcaaaagaagcggttaagcgcgcagctgtctatcag
aagaaagtgaaatcagttctcaaggatattggagaaggtgctgccgatgaaacagagaag
cacttggagaaagtccgtagttcattagttagctggcttgaagatgctgaaaataaaatc
cctagtcatactgacaagttattaaaggtggtgaatgaaatgtcctcaactggacagaag
atgtttaaagaaggccgtcgtattgtgaatcaggtggctgatgctgccgaaaagaatatt
gatgatttagttaaaaagtctgggggcaaaaaatag

DBGET integrated database retrieval system