KEGG   Polynucleobacter necessarius: Pnec_0603Help
Entry
Pnec_0603         CDS       T00683                                 

Definition
(GenBank) protein of unknown function DUF1330
Organism
pne  Polynucleobacter necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1330 EthD
Motif
Other DBs
NCBI-ProteinID: ACB43855
UniProt: B1XU28
Position
complement(524008..524298)
Genome map
AA seq 96 aa AA seqDB search
MIKVIGLIELSDLNAFEQYRSQVGQTVKLRGGSIKNRGSVTDVFWNELGCAPFHTFVELE
FPSAQDAQAWASSPEYQSLVPVRSKAMKLTLFSISI
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaagttattgggttaattgagctgagcgatctaaatgcttttgagcaataccgc
tcccaagtaggtcaaacggttaaactgcgtggtggttccatcaaaaatcgaggctcagtc
actgatgtattttggaatgagctcggatgcgcaccttttcacacttttgtagagcttgaa
tttccaagtgctcaagatgcgcaggcttgggctagtagccccgaatatcaatctcttgta
cctgtacgcagtaaagccatgaaactgactttatttagcatatctatctag

DBGET integrated database retrieval system