KEGG   Polynucleobacter necessarius: Pnec_0608Help
Entry
Pnec_0608         CDS       T00683                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pne  Polynucleobacter necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDO_I Auxin_BP
Motif
Other DBs
NCBI-ProteinID: ACB43858
UniProt: B1XU31
Position
complement(527160..527591)
Genome map
AA seq 143 aa AA seqDB search
MPHPQYYQQYLLYADPLDRFSVVSFVWGPGQKTPVHNHTVWGMVGQLRGEEKGTPYYRQA
NGSFKAGESCINLPGHVDTVSPATHDIHVVENNMSDQTSISIHVYGGNIGRIHRSVFDPS
TGAEKFFVSGYANTFVPNLWNPA
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgccgcacccgcagtattaccaacaatacctcttgtatgcagaccccttagatcggttc
tcagttgtcagctttgtatggggccctggacaaaaaactccggtccacaatcacaccgtt
tgggggatggttggtcaactacgcggcgaagaaaaaggcactccttattatcgacaagca
aatggtagctttaaagcgggtgaatcctgcatcaacctaccaggacatgttgatacggtc
tcaccagcaacgcacgacatacatgttgtagaaaacaatatgagtgatcagacttcaatc
agtattcatgtctatggtggcaacattggacgtatacatcgctcagtctttgacccctcc
actggagcagaaaaattttttgtttctggctacgcaaatacctttgtaccgaacctctgg
aatccagcgtaa

DBGET integrated database retrieval system