KEGG   Polynucleobacter necessarius: Pnec_0628Help
Entry
Pnec_0628         CDS       T00683                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
Organism
pne  Polynucleobacter necessarius
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ACB43875
UniProt: B1XU48
Position
complement(538642..539421)
Genome map
AA seq 259 aa AA seqDB search
MITRSTPPCLDLEINGNIARVIFNNPSARNALTWPMYEELKKICDSLAKNTDIRAVIFRG
AGDKAFVSGSDIQQFVDLKENEAFEIAVDHIFASLQQLPMPTIALIEGLAVGSGLLMATA
CDFRISTPEARFGIPVAKTLGNCLSPSNLSWLASHLGVPTVKKMLLTAELIKAPELLETG
YLYQIVETIEIETATNALAQKLAALAPITQKASKLTLARLLQSNLPDCTDLMRETYNSKD
FREGVNAFLEGRPPKWIGK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgataacccgctctaccccaccctgcctagatttagaaatcaacggaaatattgcccgc
gttatttttaataatccgagtgcccgcaatgccctaacttggccaatgtatgaagagctt
aaaaagatttgcgactcactagctaagaatactgatattcgagcagtgatttttcgaggt
gctggagataaagcatttgtttcgggaagcgatattcaacagttcgttgatctcaaagaa
aatgaggcttttgagattgctgtagatcatatcttcgcctccctacaacaactgccaatg
cctacgattgccttaattgaaggtctggcagtaggaagtgggctcttaatggcaacagct
tgcgattttcgcatctctacgcccgaagcacgctttgggatcccggtagccaagactctc
ggaaactgtttatcaccaagcaatttatcttggcttgcatcccatctcggagtgcctaca
gtaaaaaagatgttgctcactgcggaattaattaaagcaccagaattattggagacggga
tatctgtatcaaatagtcgaaacgatcgagattgaaacggcgacaaacgcattggcacaa
aaattagctgccctagcacctatcactcaaaaagcaagcaagctcacattggctcgcttg
ctccagagcaacttaccagattgcacggatctcatgcgtgaaacctataacagtaaagac
tttagagagggagtaaacgccttcttggaaggtcgtccacccaaatggataggcaagtaa

DBGET integrated database retrieval system