KEGG   Polynucleobacter necessarius: Pnec_0656Help
Entry
Pnec_0656         CDS       T00683                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pne  Polynucleobacter necessarius
Brite
Enzymes [BR:pne01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Pnec_0656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_23 RrnaAD
Motif
Other DBs
NCBI-ProteinID: ACB43895
UniProt: B1XU68
Position
569289..569945
Genome map
AA seq 218 aa AA seqDB search
MKAPTERFAAYRQALAAKVHAGGIKHGKTLEAIATVPRHAFMDAGLHAQAYEDTALPIGH
EQTLSKPSVVARMIELLHKPKHKLGKVLEIGTGCGYQAAVLSLLADEVYSIERIRPLHDM
ARAKLRPFWINNLRLIYGDGILGLPQAALFDGIILAAASLGIPDALLDQLSIGGRLVAPV
AKNDKEQQLVMVERMSSQRYQRTVLDEVFFVPLQSGVV
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggcaccaacagaacgctttgccgcctaccggcaagctctagcggcaaaagtgcac
gctgggggcattaagcacggcaaaaccttggaagctattgctactgttccaaggcatgca
ttcatggatgcaggcttacatgcccaagcctatgaggatacggccttacccatcggccat
gaacaaacgctttctaagccatctgttgtagcgcgcatgattgagctgctacataagcca
aaacataagcttggcaaagtattggagattggtacgggttgcggctatcaggcagcggtg
ctgagtttgcttgcagatgaggtttactcaatcgagcgcatacgccctttacatgatatg
gctagagccaaattacgtccgttttggattaataatctgcgcctaatttatggcgatggt
atcttgggtttgcctcaagccgcactatttgacgggattattctggctgcagcaagtttg
ggtattccggatgctttactagaccagctatctattggtggtcgcctagttgccccagtt
gccaaaaatgacaaagagcagcagcttgtcatggtggaaagaatgagctcccagcgctat
caaagaactgtgctggacgaggtcttttttgtccccttacaatcaggggtagtatga

DBGET integrated database retrieval system