KEGG   Polynucleobacter necessarius: Pnec_0756Help
Entry
Pnec_0756         CDS       T00683                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pne  Polynucleobacter necessarius
Pathway
pne00010  Glycolysis / Gluconeogenesis
pne00620  Pyruvate metabolism
pne00640  Propanoate metabolism
pne00680  Methane metabolism
pne01100  Metabolic pathways
pne01110  Biosynthesis of secondary metabolites
pne01120  Microbial metabolism in diverse environments
pne01130  Biosynthesis of antibiotics
pne01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pne00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pnec_0756
   00620 Pyruvate metabolism
    Pnec_0756
   00640 Propanoate metabolism
    Pnec_0756
  Energy metabolism
   00680 Methane metabolism
    Pnec_0756
Enzymes [BR:pne01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Pnec_0756
Lipid biosynthesis proteins [BR:pne01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pnec_0756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N DUF1967
Motif
Other DBs
NCBI-ProteinID: ACB43977
UniProt: B1XUF0
Position
653393..655297
Genome map
AA seq 634 aa AA seqDB search
MKHGTIKKLCDEAITDYDGFWGRLAKENIYWKKSFTKVLDESKAPFYKWFEDGITNASYN
CLDRQVEAGFGDKTAIIFEADDGTVTKVTYKEMLERVCKMANALRKMGVKSGDSVIIYMA
MTIEGIVAMQACARIGAIHSVVFGGFSAQALRDRIMDVGAVAVITADGQFRGGKALLLKA
ICDEALSTGECPKVKHVIVSKRTGTDVPMQAGRDIWTQEIIANEATTCEPEWVSAEHPLF
ILYTSGSTGKPKGVQHSTGGYLLWAILTMKWTFDIKPNDVFWCTADIGWVTGHSYITYGP
LAVGATEIVFEGVPTYPNAGRFWDMIQKHKASIFYTAPTAIRSLIKASSNDQAVHPKSYD
LSSLRLLGSVGEPINPEAWMWYYENVGGSRCPIADTFWQTETGGHMISPLPGATPMIPGS
CTLSLPGIQAAIVDEAGVDVPNGQGGILVVKRPWPSMIRTIWNDPDRFVKSYFPEELGGT
LYLAGDGAIRNKNTGYFTITGRIDDVLNVSGHRMGTMEIESCLVANPLVAEAAVVGRPDD
LTGEAICIFVVLKGGRPTGEEAKKVATELRNWVGKEIGPIAKPKDVRFGDNLPKTRSGKI
MRRLLRVIAKGEEVTQDTSTLENPHILEQLKESL
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcatggaaccattaaaaaactttgcgatgaagcgattacggattacgacggtttt
tggggtcgtcttgctaaagaaaatatttactggaaaaaatcattcactaaagttttggat
gaatccaaagcgcctttctacaaatggtttgaagatggcataacgaatgcttcttataac
tgtttagaccgtcaagttgaagctggttttggcgacaagactgccatcatttttgaggct
gatgacggcactgttactaaggtaacttacaaagagatgcttgagcgcgtttgcaaaatg
gcaaatgcactgcgtaagatgggtgtgaagtctggtgacagcgtcattatttatatggca
atgaccatcgaaggtattgttgcgatgcaggcatgtgcccgtattggtgcaattcactct
gtcgtatttggtggcttctctgcacaagctctacgtgatcgcattatggacgttggtgca
gttgcagtgattactgctgatggccagttccgcggcggcaaagctttgctactcaaagca
atttgtgatgaagctctttctacaggtgagtgccctaaagttaagcatgtcatcgtgagc
aagcgcaccggtactgatgtacctatgcaggcaggtcgcgatatttggacgcaagaaatc
atcgcgaatgaagcaacgacttgtgagccagagtgggtaagcgctgagcacccattgttc
attctgtatacatccggttcgactggtaagccaaaaggtgttcagcactctactggtgga
tacctcttgtgggccattctcacaatgaagtggacttttgacatcaagccaaacgatgtg
ttctggtgtaccgctgacattggttgggtaacaggtcactcatacattacttatggcccg
ctcgcagttggcgctactgaaattgtgtttgaaggtgttcctacctatccaaatgctggc
cgtttctgggacatgatccaaaaacacaaagcatctattttctatacagcaccaacagca
attcgttcattgatcaaagcatcaagcaatgatcaagctgttcatccgaagagctacgat
ttgtcatcactgcgtctcttgggttctgtaggcgagccaattaatcctgaagcttggatg
tggtactacgagaatgtgggtggctcacgttgcccaatcgccgacactttctggcaaaca
gaaactggcggtcatatgatttctccattgccaggtgcaactccaatgattccaggttca
tgcacattgtcattgccaggtattcaggcggcgatcgtcgatgaagctggtgtagatgtt
ccaaatggccaaggcggtattttggttgtgaaacgtccatggccttctatgattcgtacg
atttggaatgatcctgatcgtttcgtgaagtcttatttcccagaagagttgggcggtact
ttgtatctggcaggtgacggcgcaatccgtaataaaaatactggctacttcactattaca
ggtcgtatcgatgacgtcttgaacgtttccggtcatcgcatgggaactatggaaattgaa
tcttgcttagttgcaaatccattagttgctgaagctgcggttgtgggtcgtcctgatgat
ctgactggtgaggctatctgcatattcgtggttctcaaaggtggtcgtccaacaggtgaa
gaggctaaaaaagttgctaccgaattgcgcaactgggttggcaaagagattggcccaatt
gctaagcctaaggacgttcgtttcggtgataacttgcctaagacccgttctggcaagatc
atgcgccgtctcttgcgtgtgattgcaaaaggcgaagaggttactcaagacacctcaacc
cttgaaaatccgcatatcttggagcagctcaaagaatctctgtaa

DBGET integrated database retrieval system