KEGG   Polynucleobacter necessarius: Pnec_0914Help
Entry
Pnec_0914         CDS       T00683                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pne  Polynucleobacter necessarius
Pathway
pne00071  Fatty acid degradation
pne00072  Synthesis and degradation of ketone bodies
pne00280  Valine, leucine and isoleucine degradation
pne00310  Lysine degradation
pne00362  Benzoate degradation
pne00380  Tryptophan metabolism
pne00620  Pyruvate metabolism
pne00630  Glyoxylate and dicarboxylate metabolism
pne00640  Propanoate metabolism
pne00650  Butanoate metabolism
pne00900  Terpenoid backbone biosynthesis
pne01100  Metabolic pathways
pne01110  Biosynthesis of secondary metabolites
pne01120  Microbial metabolism in diverse environments
pne01130  Biosynthesis of antibiotics
pne01200  Carbon metabolism
pne01212  Fatty acid metabolism
pne02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pne00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pnec_0914
   00630 Glyoxylate and dicarboxylate metabolism
    Pnec_0914
   00640 Propanoate metabolism
    Pnec_0914
   00650 Butanoate metabolism
    Pnec_0914
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Pnec_0914
   00072 Synthesis and degradation of ketone bodies
    Pnec_0914
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pnec_0914
   00310 Lysine degradation
    Pnec_0914
   00380 Tryptophan metabolism
    Pnec_0914
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Pnec_0914
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pnec_0914
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Pnec_0914
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pne04147]
    Pnec_0914
Enzymes [BR:pne01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Pnec_0914
Exosome [BR:pne04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pnec_0914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACB44112
UniProt: B1XUT5
Position
complement(790577..791761)
Genome map
AA seq 394 aa AA seqDB search
MSRDVVVLSAVRSAIGAFNGSLSSFEPSELGGIVMKEAVARSGVDPALINYITVGNTIPT
DSRYAYVARVASVQAGLPMESVAMALNRLCSSGLQAIVTTAQQIMLGDCDYGIGGGVEVM
SRGMYGSPAMRSGARMGDTKMLDLMVSVLTDPFGVGHMGVTAENLVEKWKLTREEQDAFA
VESHRRAAHAIKEGRFKSQIVPITIKTRKGEVVFDTDDHCKPDTTMETLAKMKAVFKKEG
GSVTAGNASGINDGAAFFVLADAETAKKAGHKPIARLVSYAVAGVPNHIMGEGPIPATKL
ALERAGLKLDQIDVIESNEAFAAQALAVTKGLGLDPAKTNVNGGAIALGHPIGCSGAAIA
TKAIHELHRVQGKYALVTMCIGGGQGIATIFERL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtgatgtcgttgtcttaagcgcagttcgttccgcaattggtgcctttaacggt
tcgctcagcagctttgagccgtctgagcttggcggcatcgtaatgaaagaagcggtagca
cgctccggtgtggatccagcattaattaattacattactgttggtaacactattcctaca
gatagtcgctacgcttatgttgcacgtgttgcttcagttcaagcaggccttccaatggaa
tccgttgcgatggcattaaatcgtttgtgcagctctggtttgcaagccatcgtcactact
gctcagcaaattatgttgggtgactgtgattacggtattggtggtggcgttgaggtaatg
tcacgcggtatgtatggttcaccagcaatgcgcagcggtgcgcgtatgggtgatactaag
atgcttgacttgatggtttctgtattaacagacccgttcggcgttggtcatatgggcgtt
acagcagaaaaccttgttgaaaaatggaagcttactcgtgaagagcaggatgctttcgcc
gttgaatcacatcgccgtgcagcacatgcaattaaagaaggtcgtttcaaatctcagatc
gtccctatcactattaagactcgtaagggcgaagtagtgtttgatactgatgatcattgc
aagccagatacaacaatggaaacattggcaaagatgaaggcagtgtttaagaaagaaggc
ggctcagttactgcaggtaacgcttcaggtatcaatgatggcgctgcattctttgtcttg
gctgatgctgaaacagccaaaaaagctggtcataaaccgatcgcccgtttagtttcttat
gcggttgctggcgtgccaaatcacatcatgggtgaaggtccaattcctgcaacaaaattg
gcgcttgagcgcgctggccttaaattagatcaaattgatgtgattgagtctaacgaagcg
tttgctgcacaagcattagccgttactaaaggcttgggcttggatccagccaagactaac
gtcaatggaggcgctatcgctttaggccatccgattggttgctctggtgccgcaattgct
acaaaagcaattcatgagctacaccgcgttcaaggtaaatacgctttggtaacaatgtgt
attggcggtggtcaaggtattgcaactatttttgagcgtctctaa

DBGET integrated database retrieval system