KEGG   Pseudoalteromonas nigrifaciens: PNIG_a0714Help
Entry
PNIG_a0714        CDS       T05271                                 

Gene name
fbaA
Definition
(GenBank) fructose-bisphosphate aldolase, class II
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
png  Pseudoalteromonas nigrifaciens
Pathway
png00010  Glycolysis / Gluconeogenesis
png00030  Pentose phosphate pathway
png00051  Fructose and mannose metabolism
png00680  Methane metabolism
png01100  Metabolic pathways
png01110  Biosynthesis of secondary metabolites
png01120  Microbial metabolism in diverse environments
png01130  Biosynthesis of antibiotics
png01200  Carbon metabolism
png01230  Biosynthesis of amino acids
Module
png_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:png00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PNIG_a0714 (fbaA)
   00030 Pentose phosphate pathway
    PNIG_a0714 (fbaA)
   00051 Fructose and mannose metabolism
    PNIG_a0714 (fbaA)
  09102 Energy metabolism
   00680 Methane metabolism
    PNIG_a0714 (fbaA)
Enzymes [BR:png01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     PNIG_a0714 (fbaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: ASM52994
UniProt: A0A379HDH8
Position
I:692818..693882
Genome map
AA seq 354 aa AA seqDB search
MALISMRQLLDHAAEHGYGVPAFNVNNQEQMRAIMEAADKTNSPVIVQGSAGARAYAGAP
FIRHMILAAVEEWPHIPVVMHQDHGTSPGVCQRSIQLGFSSVMMDGSLLSDGKTPSSYEY
NVEVTRKTVEMAHACGVSVEGELGVLGSLETGEAGEEDGIGAEGKLTTEQMLTNPEEAAD
FVNKTHVDALAIACGTSHGAYKFTRPPTDDILAIDRIKAIHARIPNTHLVMHGSSSVPQE
WLEIINQYGGEIPETYGVPVEQIIEGIKFGVRKVNIDTDLRLASTGAVRRHLALNPANFD
PRKFLAAATQAMTDICISRYESFGTAGQASKIKPISLDEMHLKYLSGELDPRIK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggctttaatcagtatgcgacaacttctggatcatgccgctgagcatggttatggcgta
cctgcttttaacgttaacaaccaagagcaaatgcgcgcaataatggaagcggctgacaaa
accaatagccctgtaattgtgcaaggttctgcaggcgcacgtgcttatgctggtgcccca
tttattcgtcatatgattttagcagcggttgaagagtggccacatattccagtggttatg
catcaagatcacggtacatcaccgggtgtatgtcagcgttcaattcaacttgggttttca
tcagtaatgatggacggctcattattgagcgatggtaaaacaccttcaagctacgaatat
aacgtagaagtaacccgtaaaactgtagaaatggcacatgcgtgtggtgtttctgttgaa
ggcgaactgggtgttttaggttcgcttgaaacaggtgaagcaggcgaagaagatggtatt
ggcgcagagggtaaattaaccactgagcaaatgctaactaatccagaagaagcggctgac
tttgtaaataaaacccatgttgatgcgctggcaattgcttgtggtacatcgcacggtgcg
tataaatttactcgtccaccaacggatgatattttagcgattgatcgtattaaagcaatt
catgcacgtattccaaatactcacttagtaatgcatggctcatcatcggttccacaagaa
tggttagaaataattaatcagtacggtggcgaaattccagaaacttacggtgtgccagta
gagcaaattattgaagggattaagtttggcgtacgtaaagttaatattgatacagactta
cgtttagcatctaccggtgcggtgcgtcgccatttggcgcttaatccggcaaacttcgat
ccgcgtaaatttttagcggcagcaactcaagccatgaccgatatttgtatttcgcgttat
gagtcgtttggtacagcaggccaagctagcaaaattaaaccaatttcattagatgaaatg
catcttaagtatttaagcggcgagttagacccacgcattaaataa

DBGET integrated database retrieval system