KEGG   Pseudoalteromonas nigrifaciens: PNIG_a2626Help
Entry
PNIG_a2626        CDS       T05271                                 

Gene name
truC
Definition
(GenBank) tRNA pseudouridine65 synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
png  Pseudoalteromonas nigrifaciens
Brite
KEGG Orthology (KO) [BR:png00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:png03016]
    PNIG_a2626 (truC)
Enzymes [BR:png01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     PNIG_a2626 (truC)
Transfer RNA biogenesis [BR:png03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    PNIG_a2626 (truC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ASM54624
UniProt: A0A379H909
Position
I:complement(2382920..2383684)
Genome map
AA seq 254 aa AA seqDB search
MSERPIPIEYGELTILYQDENYVAIDKPSGLLVHRSFLDKHETQFAMQMLRDQLGQHVFP
VHRLDRPTSGVLLFALSSEAARDMNQLFIEGTISKRYLALVRGFAPESVFLDKPLKEELD
KIADKFADQDKAPQEAQTQFNCLHQAALPIPIGKYPTVRYSLVECFPKTGRKHQIRRHLK
HLSLPIIGDVNHGDNQHNQFFREHFELRRLMLFATELSFVHPYSNESITIKAPLGDAMLS
ICKQLGWPDEEKDY
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcgcccaataccaattgagtatggcgaactgactatcttgtatcaggatgaa
aactacgtagccatagataaaccctcaggcttattagtgcatcgttcgtttttagataag
cacgaaacccagtttgctatgcaaatgctgcgcgatcaacttgggcagcatgtttttccg
gtacataggctcgatagacccacatcgggggtgttactgtttgcgttaagttcagaagcg
gcccgcgatatgaatcagttatttattgaaggcactattagtaaacgctatttagcctta
gtacgtggttttgcacccgagtcggtatttttagataaaccactaaaagaagagctggac
aaaatagcagataagtttgccgatcaagacaaagcgccacaagaagcgcaaactcagttt
aactgcttgcaccaagcagccttgcctattcctattggcaagtacccaacggtgcgctat
tccctcgtagaatgttttcctaaaacggggcgtaaacatcaaattcgtcggcatttaaag
catttatcactgcctatcattggcgatgtaaaccatggtgataatcagcataatcaattt
tttagggagcattttgagctgcgcagattaatgttatttgcaactgagcttagctttgtg
cacccttatagtaatgaatcaataacaattaaagcgccactaggtgatgcaatgctcagc
atttgcaaacaactaggttggccagatgaagaaaaggattattaa

DBGET integrated database retrieval system