KEGG   Pseudoalteromonas nigrifaciens: PNIG_a3031Help
Entry
PNIG_a3031        CDS       T05271                                 

Gene name
ispA
Definition
(GenBank) farnesyl diphosphate synthase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
png  Pseudoalteromonas nigrifaciens
Pathway
png00900  Terpenoid backbone biosynthesis
png01100  Metabolic pathways
png01110  Biosynthesis of secondary metabolites
png01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:png00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PNIG_a3031 (ispA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:png01006]
    PNIG_a3031 (ispA)
Enzymes [BR:png01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     PNIG_a3031 (ispA)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     PNIG_a3031 (ispA)
Prenyltransferases [BR:png01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   PNIG_a3031 (ispA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt UbiA
Motif
Other DBs
NCBI-ProteinID: ASM54981
UniProt: A0A379H7Y1
Position
I:2782981..2783868
Genome map
AA seq 295 aa AA seqDB search
MTIKELITHAQTDVANTLNLYFDQSLNTDETIKAATHYSLMNGGKRLRPFLVYATGKMLG
ADKQDLDVLAAAIECIHSYSLVHDDLPAMDDDELRRGRPTCHIVYGEAHAILAGDALQAL
AFELIAKHNFNCSAQAQVKMIAELAHASGLQGMVAGQGLDIAATDKVITVAELERIHKLK
TGALISCAITLGALCSNNVSQNTLENLVTFGYAIGLAFQVHDDILDVEGDTVTLGKPQGS
DIAANKATYPALLGMLGAKEKAQNLIQQAHAALANIDADTSALASLANYLIERDH
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtgactattaaagaacttattacacatgctcaaactgatgtagccaatactcttaacctt
tattttgaccaatcgcttaatactgacgagaccataaaagccgccacccattatagttta
atgaatggcggcaaaagattgcgtccttttttggtttacgcaacgggtaaaatgctcggc
gcagataagcaagatttagacgtacttgctgcagctatagaatgtattcatagctactcg
ttagttcacgatgacttaccagctatggatgatgatgaattgcgtcgcggacgcccaacc
tgtcatatagtgtacggtgaagcacacgcaattttagccggtgatgcactgcaagcttta
gcatttgagttaatagccaagcataattttaactgtagtgctcaagctcaagttaaaatg
attgctgaactggcacatgcctctgggttacaaggtatggtggcaggccaagggcttgat
attgcagctactgataaagtaataaccgtggctgaacttgagcgtattcataagttaaaa
accggtgcgctaataagctgtgcaattacactgggggctttgtgctcgaacaatgttagt
caaaacacgttagaaaatttagtcacttttggctatgccatagggcttgcatttcaagta
catgacgatattttagacgtagaaggcgataccgttactttaggtaagcctcaagggtca
gatatcgctgcgaataaagcgacatatcccgctttattaggtatgctaggcgctaaagaa
aaagcgcaaaacttaatacaacaagcccatgcagcgttagcaaatatagacgccgatacc
agtgctttagcgtcactagctaactatttaattgaacgtgaccactaa

DBGET integrated database retrieval system