KEGG   Pseudoalteromonas nigrifaciens: PNIG_a3619Help
Entry
PNIG_a3619        CDS       T05271                                 

Gene name
ompR
Definition
(GenBank) two-component system, OmpR family, phosphate regulon response regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
png  Pseudoalteromonas nigrifaciens
Pathway
png02020  Two-component system
Brite
KEGG Orthology (KO) [BR:png00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PNIG_a3619 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:png02022]
    PNIG_a3619 (ompR)
Two-component system [BR:png02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   PNIG_a3619 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ASM55491
UniProt: A0A379HEN6
Position
I:complement(3328533..3329252)
Genome map
AA seq 239 aa AA seqDB search
MGHETTKVLVVDDDMRLRSLLERYLVEQGFIVRTAGNSEQMDRLIERENFHLMVLDLMLP
GEDGLSICRRLRQKENDIPIVMLTAKGDEVDRIIGLELGADDYIPKPFNPRELLARIKAI
LRRRAKEVPGAPAAEENLIEFGRFSLNLATREMSEGEKTISLTSGEFAVLKALVLHPREP
LSRDKLMNLARGRDYSALERSIDVQVSRLRRMIELDAASPRYIQTVWGLGYVFVPDGEK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgggacacgaaacgacaaaagtattggttgtagatgatgacatgcgtttacgcagctta
ctggagcgctatttagtagagcaaggctttattgtaagaacagcgggtaattcagagcaa
atggatcggcttatcgaacgtgaaaactttcatttaatggtgctcgatttaatgctgccg
ggtgaagatggtttgtctatttgtcgtcgtttacgccaaaaagaaaacgacattccaatt
gttatgcttaccgctaaaggtgatgaggttgaccgtattattggccttgaattgggagca
gacgactacattccaaaaccatttaatccacgagagctgttagcgcgaataaaagctatt
ttacgacgccgtgccaaagaagtgccgggcgcacctgctgcagaagaaaatttgattgaa
tttgggcgattttcgcttaatttagccactcgcgaaatgagcgaaggcgaaaaaacaatt
tccttaaccagtggcgaatttgcagtgcttaaagcgctggtcttgcatccacgtgagccg
ctgagccgtgataaattgatgaacctagcgcgcgggcgagattacagcgcactggagcgc
agtattgatgtgcaagtgtcgcgacttcgccgcatgattgagttagatgccgccagccca
cgttatattcaaactgtttggggcttaggatatgtatttgttcccgatggtgaaaagtaa

DBGET integrated database retrieval system