KEGG   Pseudoalteromonas nigrifaciens: PNIG_b0676Help
Entry
PNIG_b0676        CDS       T05271                                 

Gene name
phoA
Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
png  Pseudoalteromonas nigrifaciens
Pathway
png00730  Thiamine metabolism
png00790  Folate biosynthesis
png01100  Metabolic pathways
png02020  Two-component system
Module
png_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:png00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PNIG_b0676 (phoA)
   00790 Folate biosynthesis
    PNIG_b0676 (phoA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PNIG_b0676 (phoA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:png04147]
    PNIG_b0676 (phoA)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:png00537]
    PNIG_b0676 (phoA)
Enzymes [BR:png01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PNIG_b0676 (phoA)
Exosome [BR:png04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PNIG_b0676 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:png00537]
 Enzymes
  PNIG_b0676 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase
Motif
Other DBs
NCBI-ProteinID: ASM56222
UniProt: A0A379I463
Position
II:complement(607889..609178)
Genome map
AA seq 429 aa AA seqDB search
MKKQLSLLALLCSATGAYADSAPKNIIYMIGDGMGPAYTTAYRYFKDDSNTKAIESTVFD
TILTGMAHTYPDDHTYVTDSAASATALSSGHKSYNGAIGVDTNKKPVKTMLEIAKERGMT
TALVATLQINHATPASFAAHNESRGNYDEIANDYIDNKIAGKLPVDLMLGGGTKYFIRED
RNLIEEFKAAGYQYSDDINNLGQITQLPAIGLYAEKGLPYAIDEHPNRLARLTTKTLDLL
DGQNKEGFFVMIEGSQIDWCGHANDIACAMAEMDDFAKSVEKAKAYVDKNQDTILIVTAD
HSTGGLTLGAHGQYKWDTEIVKGVKASAGKLTSLLMDASDLKTVWSANTNIEFSAEHQIK
LEQAKKMGKKPLNLAIKSIINDASFTGWTTGGHTAVDVQVFAYGKGSEQFTGSQNNTDIA
DKLIAFIEK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacagctcagtttattggcgcttttatgcagcgcaacaggtgcttatgcagat
tcggcaccaaaaaatattatttatatgattggcgatggtatgggcccagcttatacaact
gcttatcgctactttaaagacgattcgaacacaaaagcaattgaaagcactgtattcgat
actattttaactggcatggcacacacctacccagacgatcatacttatgttaccgacagc
gcagcaagcgctacagcgttaagcagcggccataaaagctataacggtgctattggcgta
gataccaataaaaagcccgttaaaacgatgttagaaattgcaaaagagcgcggtatgacc
acggcacttgtcgctactttgcaaattaaccacgccacaccggcaagctttgcagctcat
aatgaatctcgcggtaactacgatgaaattgctaatgattacattgacaataaaattgcg
ggcaagctacccgttgatttaatgctaggtggagggactaaatattttattcgtgaggac
cgtaacttaattgaagaatttaaagctgctggttatcaatactccgacgacattaataac
ctaggccaaattacgcagctccctgccattggtttatacgccgaaaaaggccttccatac
gcaattgatgagcaccctaatcgccttgcacgattaaccactaaaacacttgatttatta
gatggccaaaacaaagaaggcttttttgtgatgattgaaggcagccaaattgactggtgt
ggccatgctaacgatatagcctgtgctatggcagaaatggacgattttgctaaatcggtc
gaaaaagcaaaagcatacgttgataaaaaccaagacacgattttaattgttaccgcagat
cactcaacaggtggtttaacacttggtgcccacggacaatacaagtgggataccgaaata
gttaaaggcgttaaagcctcggctggtaaattaacctcgctattaatggatgccagtgat
ttaaaaacagtttggtcggctaatactaatattgagtttagtgctgagcaccaaattaaa
cttgagcaagctaaaaaaatgggtaaaaagcctttaaatttagccattaaaagtattatt
aacgatgccagctttactggctggacaactggtggccacactgctgtagatgtacaagta
tttgcctatggtaaaggtagcgagcaatttacgggctcacaaaacaatactgacattgcc
gataagctaattgcatttatagaaaaataa

DBGET integrated database retrieval system