KEGG   Candidatus Protochlamydia naegleriophila: PNK_2304Help
Entry
PNK_2304          CDS       T04212                                 

Gene name
pitA
Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pnl  Candidatus Protochlamydia naegleriophila
Brite
KEGG Orthology (KO) [BR:pnl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    PNK_2304 (pitA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: CUI17902
UniProt: A0A0U5JEG2
Position
cPNK:complement(2698558..2699973)
Genome map
AA seq 471 aa AA seqDB search
MDTALLILILVTGFYMAWNIGANDVANAMGTSVGSGSLTLRQAVIIAAILEFCGAFFFGS
HVSKTMQSGIINPDVFVHDPRILVYGMLASLASVGMWLQLASYFGWPVSTTHSIVGAIVG
FGAVVGGLEAVYWKDVGYIICSWILSPVLGGVLAYYIFTLLRKKIFYALNPLEATRKLTP
LLVFIVVSILALVLVFEGLHNLNLELTLLTKIAITVGAGLLGAFISHLVMRRIPITQHGK
PHNEYDPEAMQSLEKVQKHLQRFHSKSNGEAQYTAGLLMEEVNTLSKSLKPRMELDHTHE
EYNRVETVFAYLQIMTACMMAFAHGANDVANAIGPLSAAVTILTTGLFAVEAPVPTWALA
LGGSGIVVGLATWGWRVIETIGKKITELTPSRGFAAEFGAATTIVLASRLGLPISTTHTL
VGAVLGVGFARGLEAVNLTTTRDILISWVVTVPIGALLAVALFYPIRAVFG
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggatactgctctgctgattttaattttggtaacaggcttttacatggcctggaatatc
ggggctaatgatgttgccaatgccatgggaacatctgtaggttccggttctttgacccta
cgtcaagctgttatcattgcagctattttagagttttgtggtgcttttttctttggctcc
cacgtctctaagaccatgcaaagtggcattattaatccagatgtttttgtccatgaccct
agaatcctcgtttacggcatgttagcctctttggcttctgttgggatgtggttgcaatta
gcctcctattttggctggccggtttcaacgactcactcaattgtcggagctattgtggga
tttggagccgttgtcggagggctcgaagctgtttactggaaagatgtcggttatattatc
tgtagctggattttgtctcctgttttaggcggagtccttgcttattatatttttactctt
ctgagaaaaaaaattttctacgctttaaatcctttggaagccacgcgcaaacttacccct
ttattggtatttattgtggtaagcatccttgccctggtcttagtttttgaagggttgcac
aatttaaatcttgaacttaccctgttgaccaaaatagccattacagttggggcggggctt
ttgggagcgtttattagccatctcgtcatgcgccgcattcccattacacaacacgggaag
ccgcacaatgagtacgatccagaggctatgcagtcgttggagaaagttcaaaagcatttg
cagcgctttcattctaagtctaatggggaggcccaatataccgcgggtttgttgatggaa
gaggtcaataccctttccaagtcacttaaacctcgaatggagctcgatcatactcatgaa
gagtataatcgagtcgaaacagtttttgcttatcttcaaattatgacagcttgcatgatg
gcttttgcccacggcgccaatgacgtcgctaatgcgatcggccccttgtcagctgctgtg
actattttgactactggactttttgcggttgaagctccggttcccacttgggcactcgca
cttggtgggagcggcattgtcgttggcttggcaacgtggggctggcgcgtcattgaaact
attgggaaaaaaattacagagctgactccaagccgaggctttgcagccgaatttggtgca
gcgacgacgattgtactggcctctagacttggacttcccatttcaacgactcatacacta
gtcggagccgttttaggtgtcggttttgcaagaggccttgaagccgtcaatttaacaaca
acgcgcgatattctcatttcttgggttgtcaccgtaccgatcggcgctcttttagccgtt
gccttattttatcccattcgcgcggtattcggataa

DBGET integrated database retrieval system