KEGG   Parastagonospora nodorum: SNOG_00996Help
Entry
SNOG_00996        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K02365  separase [EC:3.4.22.49]
Organism
pno  Parastagonospora nodorum
Pathway
pno04111  Cell cycle - yeast
pno04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:pno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    SNOG_00996
   04113 Meiosis - yeast
    SNOG_00996
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pno01002]
    SNOG_00996
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pno03036]
    SNOG_00996
Enzymes [BR:pno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     SNOG_00996
Peptidases and inhibitors [BR:pno01002]
 Cysteine peptidases
  Family C50: separase family
   SNOG_00996
Chromosome and associated proteins [BR:pno03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Separase
    SNOG_00996
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT
Motif
Other DBs
NCBI-GeneID: 5967632
NCBI-ProteinID: XP_001791657
UniProt: Q0V4R8
Position
Unknown
AA seq 2202 aa AA seqDB search
MATKDEQTRLRIDEVKANLRSTTTCSPATVTTLQELLLKKSEEPAQKENVRAKAQTTARR
RAGTATATANVEVKDSAITLSPREKYILATEVANTTLKNLADALKTPSYATAQKTSPPTK
PTTSDDARKPVRSRAGHTKSASVSQRPLKERSASQISNAPQKPAIRRSSSYSSFLTTGPD
TGLVSTAECARIAFSYLGTVEATKVLGKDSQELQLESGILALIGKLVALGLDGLAVKEMR
HLKKRLDKYLGHDVEAQRPGSRIAEKGAQNAGSGDKESLASLLDFAEIGAESPAVPIVVN
LQIYALRVIAKLSRPRIVEATWDYLKLSNPSSPANLIHHMATSPGGQVKAARQLESLAQT
ILSLCPQIASSHDEKPLQPSTETVLLLQQLAFKVRKTWWSLAKHQGNEEKELLEPFTKCL
TAFARRSQISPNKKYRLAATLYEDLKSGQRGQEGAHASNTAVNQTLSSLAQAAGLSEEAV
RWLGTAQPASSSTGSSAKQSARIVRIATVTIEGFVKDNSTPGLEDAVSNALEALGGSLSG
SGADLDTLFVEVNAFRRAATRLLMAFSTKPEQVEGQDDIRQSTIHIIAASIHFSARMVGA
KVADNADANAQRRHDARMMMLSKCTKSSLDSVLACCKQIIDSEKQWQELDVMLQECSHII
HRLEEECLLGTNADLLDSEMTESLLVKLSNAYWAVYLQLRKAKFTSAILITAIQRSINLV
HMRSQDVRSGGHLIMKLEQLGDTLEGLDSAAKSRKAYTQCLQAHLESDASQKLADAAANK
PLQEIFADQGPLGTFNRVLKSHHRSFLKSGISDAKEMAFFDHSGLQSEVRGVLLEYQLNL
YLHTLSKNRHWDTNLNSSVTGLVESLQDLYAAKQYPIRRLRLLASLLQLSQSHADVVSIK
SLEADALQTSLIDISGSQDEGLMRFGPHLNAFCKLKILTQEPVPQAPILRECFSTWESII
ATSSSWQSLADRVDDTASWLSDLKTSVEYLNVNGEEYLALPVLNLLVKAGELQKNPDPSD
TVTSLCALGLQFLRLGYTGKAGLSLAKAEKLVANHKPSTEARLRWHIAYAEYLARIGNTT
KGLAIMTAAYKHALADQQFMDLAKPSTTLSSRLRFNRVLADATYVYSLLSTIEGSYKDAA
KHARQCVALNRRIWAALESRATVKKAAPIDDSESDIDGPSKVAFDPLSSMRNEKGAPIVM
SVTHDALSGPEFWSLVPALYRGLMQHSQIFAHQGLLHEAVYVAEQAEKVASASKSPTLII
DNASWRADCWAQSGRPDKAQPILDSLSVDATRKCLSIIGYQSAVARVHHWTGQYEEEVAS
YDTLEQLLKDLTSPIYTKTLDTISSDVDSLVDQMSQMTVGTTKTQTTKAAVATTARGRKP
AVKATKAPVRKTTAKPAPNARSKPKTAVAEKPASTSKAKESSLENANSSEQCSVLHNFQL
EITNRRVLAHLLQEDLATASALIAQMDEHQVATARDLSHSWAAFKTMLAQSTKQIAENIA
VNTLPESTIAFPAINTKERRLSEDANGKRPALASSTAAKTGRAKKPAKSDFVETLRNARD
RLVQAHTACAANGPNYMFQQVSMALGTITVLLSAVSGDEMGGSIHPLYAAYMGEVPKCNA
LRLAQDAVEAEKDPMSRDDCLRWPNSSSTTNAPTTVSDFQRQYIDIIPETWNAVSLALND
TRDELYVTRYESGLSPFLLRLPLARHASRDMDEEEFSFEDGKRDFDEIIELSDFSTRTAK
DMTSREARQQWWAEREALDTRLHELLINMENIWLGGFKGVFSQHERQPSLLARFRKSLEN
ILNQHLPSRKKKSQAKRPTLDTRVLELFIGLGNANDEELDLDEALMDLMYFVVDILHFNG
ERNAYDEIDFDAMVVETQEALQAYHSAAQPPQTTKHTILILDNNLHGFPWESLPCLEKLS
ISRLPSLAALRERLLVARPCNDHTQQPPGHYIRVGCGGTSILNPGGDLSHTSKTLQPRLD
ELQGPWTHIANRAPTEKEFEDSLRENELVLYFGHGSGAQFVRSKAVRRLYPGQQDDHNQK
PGCATTFLFGCSSVHLTENGIYEPSGMLASYLTAGAPAVVGMLWDVTDKDCDRFAIKAGE
LWGLWPEPQEDAARVVPKTPGRKAKGKGRVAQLADDLEGTRAPGSAKKGKKAKIVNDEAE
PVGERRRGLGLDECVREARKSCILRYLNGAAAVVYGIPVYLE
NT seq 6609 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaaggacgagcagacgcgtctgcgcatcgacgaagtaaaggcgaacctccgg
tccacgacgacgtgttcacctgcaaccgtcacaacactgcaggaattgcttttgaagaaa
tcggaggaacctgcacagaaagagaatgtcagagccaaagcacagactacagcgcggagg
agagcaggaacggcgactgctacagccaatgtggaggtcaaggactctgcaataacactc
tcgccaagggagaaatacatactggctaccgaagtcgccaacaccaccctcaagaacctc
gcagacgctctgaagaccccctcgtatgcgaccgcccagaaaacgtctccgccaacaaag
cccaccactagcgacgatgcgcgaaagccagtccgatcgcgggcaggacacacaaagagc
gcctctgtctcgcagcgccctttgaaggaacgatctgcctcgcagataagcaatgcgcca
caaaagccggcgatacggcgatcttcgtcatactcctccttcctgactacaggccccgat
acgggcctggtctccacagccgagtgcgctagaattgcattttcatacttggggacagtg
gaagccacgaaagtgctgggcaaagattcacaggagctacaattggagagcggcattctg
gcgctcattggaaaattggttgcgcttggacttgatggccttgctgtcaaggagatgcga
cacctgaagaaaaggctggacaaatatttgggtcacgatgttgaggcacagcgccctgga
agtcgaatcgctgagaagggagctcagaacgccggatcgggagataaggaaagcctggca
tcgcttttggattttgcggaaatcggagctgaaagtccggcggtaccaatcgtcgtcaac
cttcaaatatacgcgctacgagtaatcgcaaaactgagccggcctcgcatcgtcgaagcc
acctgggactacctgaagctgtccaacccttcgtcccccgcaaacttgatacatcacatg
gcgacctcgccaggtggtcaagttaaagctgcgagacagcttgaatctctcgcccaaacg
atcctctcgctctgtccacaaatcgctagctcacacgatgagaaacccctacagccatcg
acggaaactgtcttacttttgcaacagctggcattcaaggtccggaagacgtggtggagc
ttagcaaagcatcagggaaacgaagagaaggagttgctagagcccttcacgaagtgcttg
actgccttcgcaagaagatcgcaaatatcaccaaacaaaaaatacagactggctgcaacg
ctatacgaagatttgaaatcgggccagcggggccaggaaggtgcacatgcatcaaacaca
gcagtcaatcaaaccctcagttctttagctcaggccgcagggctgtctgaggaagcagtt
cgatggttgggtacagcgcagcctgcttcctcatcaactggatcctccgctaaacaaagc
gctcgcatcgtgcgaatcgcgactgttactatcgaaggctttgtcaaggacaattcgacg
ccgggtctagaagatgcagtcagtaatgcacttgaggcattgggaggtagccttagtggg
tctggcgcagatctggacacactttttgtggaagtcaatgccttcagacgtgcagcaact
cgacttctcatggctttctccacgaaacctgagcaggttgaagggcaggatgatatcagg
caaagcaccatccacatcatcgcggcgagcatacatttttcggccaggatggttggtgcg
aaagttgcagacaacgcagatgcaaacgcacaacgtcggcacgatgcgcggatgatgatg
ttgtccaagtgcacgaagagtagcctcgactctgtgttagcatgttgcaaacagatcatc
gactcggaaaaacaatggcaagaactcgatgtcatgctgcaagaatgctcgcatatcata
catcgacttgaagaagaatgtttgctcggtacaaatgccgacttactagactccgaaatg
actgagtcactactcgtgaaactttccaacgcgtattgggctgtctatcttcagctaagg
aaagccaaattcacgtcagcgattctcattacagcaatacagcgctctattaatctcgta
catatgagatctcaagacgtgcggtctggaggtcatctcatcatgaagctcgagcagctc
ggtgatactctcgaaggcttggacagcgctgcgaagtcacgaaaagcctacacgcagtgt
ctccaggcacacctagaatcagacgcgtctcaaaaactagcagatgctgcagcaaataaa
ccacttcaagaaatcttcgcggaccagggcccattgggcacgttcaatcgtgtcttgaag
tcgcatcatcgcagtttcctcaaatccggcatatcagatgctaaagagatggcattcttt
gaccactccggtttacagtctgaagttcgaggtgttcttctagagtaccagctcaatctc
tatctacatacattgtccaagaaccgacattgggacaccaacctcaattcatcggtcact
ggccttgtggaaagcctccaagatctttacgcagcgaagcagtatcccattcgacggcta
cgactacttgcgtccttgcttcagctctctcaaagtcatgctgatgttgtttcaataaag
tctttggaagcagatgcgttgcaaacgtctctgatcgatatttcaggctcccaggacgaa
ggcttgatgcgatttggcccgcatctgaacgccttctgtaagctcaagatcttgacacaa
gagcctgttccacaggcgccaatccttcgcgagtgcttctctacgtgggagtccatcatt
gccacgtcgtcctcctggcaaagccttgcggaccgtgttgatgataccgccagctggctc
tccgacttgaagacgagtgtcgagtatctcaacgtgaatggcgaggagtatttagcatta
cccgtacttaacctccttgtgaaagcaggcgagctgcaaaaaaatcccgatccatctgac
acggtcacaagcctctgtgctctgggactgcagttccttcgtctcggctacactggaaaa
gccggactttcgttggctaaggcagaaaagctggtcgccaaccacaagccatctacagag
gccaggctgcgatggcatattgcgtatgctgagtacctggctcgaattgggaatacgacc
aagggtcttgccatcatgactgctgcatataagcacgctctcgcggatcagcagttcatg
gatctggctaaaccatcaactactctctcgtcgagactacgcttcaatagggtattagct
gatgccacatacgtctactcgcttctatcgacaattgaaggcagttacaaggatgctgcg
aagcatgcgagacaatgcgtggctctcaatcgacgtatctgggcggcattggagtcaaga
gccactgttaagaaggctgcgcctattgatgattctgagtcggacattgatgggcccagc
aaggtagcattcgatccattgagctcaatgcgtaacgagaagggcgcacctatcgtcatg
tccgtcacacacgatgccctgagtgggccagagttttggtctctggtgcccgcattatat
cggggactgatgcagcattcccaaatattcgctcatcagggattgctgcacgaggctgtc
tacgtcgcagaacaagccgagaaggtcgcttccgcttcgaaatcacccactctcataatc
gacaatgccagctggcgggcagattgctgggctcagagcggcagacccgataaagcgcaa
cctattcttgattctctctcggttgatgcgacccgaaaatgtctttcaatcataggctac
caatccgctgttgccagagtccaccactggactggtcagtacgaagaggaggttgcgtcg
tacgatacgctcgaacagcttttgaaggacctgacatcgccaatatacacaaaaactctg
gacacaatctcttctgatgtcgacagccttgttgatcaaatgtctcagatgactgtcggc
acaacaaagacccaaacaactaaagctgcagtagcaacaacagcacgaggtcgcaagcct
gcagtaaaggctaccaaggccccggtacggaagacaactgcaaagcctgctccaaacgct
agatctaagcccaagacggctgtcgctgaaaagcctgcatccacgtccaaggccaaagaa
tcctcccttgaaaatgccaacagcagtgaacaatgctcggttttgcataacttccagctc
gagatcacaaaccgacgggttcttgcgcatctgttgcaggaggacctcgcaaccgcgtct
gctcttattgcccagatggatgaacaccaagtcgctacagcccgtgatctatctcattcg
tgggcggcgttcaaaactatgctcgcgcaaagcaccaaacaaattgctgagaacattgcg
gtcaacacgttgcccgaatccaccattgccttccccgccattaacaccaaggagcgaaga
ctatcagaggacgccaatgggaaacgccctgcgcttgcatcgtcaacagcagcaaagact
ggccgcgcaaagaagcctgcaaagagtgatttcgtggagacactacgaaatgctcgagac
cgcttagtacaagcccacacagcatgcgctgcaaatggtccaaactacatgtttcagcag
gtctccatggcgctgggcactattacagtcttgctttctgcagtgtctggagacgagatg
ggtggttctatacacccgttgtatgcagcttacatgggagaagtcccaaaatgcaacgca
ctgaggctcgcgcaagacgcagtcgaagccgaaaaagacccaatgtcacgcgacgactgc
ttgcgatggcccaactcatcatccaccaccaatgcccccacaacagtgtcagactttcag
agacaatacattgacatcattccagagacctggaatgcggtgtctcttgcactgaacgac
actcgcgatgagctatatgtcacacgctatgaaagtggtttatctccatttctacttcgc
ctaccgttggctcgacatgcatcccgcgacatggatgaggaagaattctctttcgaagat
gggaaaagagacttcgacgagatcatcgagctcagtgactttagtacacgtactgccaaa
gatatgacctcgagagaggcccgtcaacagtggtgggccgaacgcgaagctctcgacaca
aggctacatgagctcctcatcaacatggaaaacatctggctcggtggtttcaagggtgtc
ttttctcagcatgagcgacaaccaagtctgcttgcccgctttcgcaagtctttggagaac
attttgaatcaacatctcccgtcccgcaaaaagaaatctcaagcaaagaggcccacgttg
gatactagggttctggaattattcattggtttaggcaatgccaacgacgaagaattggat
cttgacgaggcgttgatggacctcatgtactttgtagtcgacattctacacttcaacggc
gagcgcaacgcgtacgatgaaatcgacttcgatgccatggtcgtggaaacgcaagaagcg
ctacaagcataccacagcgcagcgcagccacctcagactaccaaacacacgatcctcatc
ttggacaacaacctgcatggatttccttgggagtcattaccctgcttggagaagctctcc
atatcccgccttccttcgctggccgcacttcgagaacgtctgctggttgcgagaccgtgt
aacgaccacacacaacagccgcctgggcattatatacgggtgggctgtggaggtaccagc
attctgaatcccggtggtgacttgtcgcacacgtcgaagacgctccagcctcgcttggac
gagctacaagggccttggacacacattgcaaaccgcgcaccaacagaaaaagaattcgag
gactcgttgcgagaaaacgaactggtgctctactttggacacggtagtggtgcccagttc
gtgcgctcaaaggctgtacgccgcctctaccctggccaacaggacgatcacaatcagaaa
cccggttgtgcgacgacattcctcttcggctgttcgtctgtgcatctcaccgagaatggc
atctacgagccgtcgggtatgcttgcttcgtacctcactgcgggtgcacctgctgttgta
ggtatgctttgggatgtcacagacaaggactgtgatcgcttcgccatcaaagcaggtgaa
ttgtggggcctctggcctgagccacaagaagacgctgcacgagtagtaccaaagactcct
ggtagaaaagcaaagggcaagggaagagttgcgcaattagcagacgatctagaaggcaca
agagcaccaggtagcgcgaagaagggcaaaaaagctaagattgtcaatgatgaggctgag
cctgttggagagcggcgtagagggttgggtttggacgaatgcgtcagagaggcaaggaag
tcatgcatcttgaggtatctcaatggggcggcagcagttgtatacggcatcccggtatat
ttggagtag

DBGET integrated database retrieval system