KEGG   Parastagonospora nodorum: SNOG_01654
Entry
SNOG_01654        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pno  Parastagonospora nodorum
Pathway
pno00100  Steroid biosynthesis
pno01100  Metabolic pathways
pno01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    SNOG_01654
Enzymes [BR:pno01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     SNOG_01654
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 5969135
NCBI-ProteinID: XP_001792290
UniProt: Q0V2W0
Position
Unknown
AA seq 499 aa
MASNGKVKANGKAAKAHVEEEHGYEFLGPPGAFIISFGLPVLVYVLTFFCNDISGCPAPS
LLHPSTLDFDQLKREVGWTGFGSLLNWEAFVGTLGYYFLSLTLYAVLPSTEVPGVPLTSG
QRLKYRFNAWNSALFILTLLAAGTITSGADFVVWTFITDNFVGIMTTNILISYFLATFCY
VRSFSVKHPKDPNNRELAAGGRTGNLLYDWFIGRELNPRVVLPIFGEVDIKAWCELRPGM
LGWIIIDLAFIAKQYHNFGRVTDSIVLVTVAQAVYSLDSLFMEPAILTTMDIIQDGFGMM
LSFGDLVWVPFTYTIQTRYLSVYPVDLGIKGIVAVLAVQGFGYYIFRSVNNEKNRFRTNP
EDPRVSHLKYIETEAGSRLLISGWWGMARHINYLGDWFMSWSYVLPTALSGYLIRNAAQH
PITAAQSDAYFFKDSYGKYAVPGEAKGWGMIFTYFFMVYFAVLLLHRERRDEEKCRRKYG
KDWDRYVEHVPYRIIPYVY
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggcgtcaaacggaaaagtcaaagccaacggcaaggccgcgaaggctcacgtagaggaa
gagcatggctatgaattcttaggaccacctggcgcgttcatcatatcattcggacttccg
gtcttggtgtatgtgttgaccttcttttgcaacgacatctcaggatgtcctgcaccttcg
ctgcttcacccttccacgctcgatttcgatcagctgaagcgagaggtgggatggactggt
ttcgggagcttgctcaattgggaggcttttgtcggaactcttggctactacttcctcagc
ctgactctgtacgctgtcctgccgagtacggaagtccctggtgttcctctcacatctggc
caaaggctcaagtaccgcttcaatgcctggaactctgcgctcttcatcctcacccttttg
gctgccggaactatcaccagcggcgctgatttcgttgtctggacattcattactgacaac
tttgtcggcatcatgaccaccaacatcctgatctcttacttcctcgctactttctgttac
gtccgctcgttcagcgtcaagcaccccaaggaccctaacaaccgtgagcttgccgccggt
ggccgcactggtaacttgctctacgattggttcattggccgtgagctaaacccgcgcgtt
gtgcttcccatcttcggcgaagtcgacatcaaggcttggtgtgagcttcgtcctggtatg
ctcggctggatcatcatcgaccttgcgttcatcgcgaagcaataccacaactttggccgc
gtcaccgactccattgtattggtcaccgtcgcccaggcagtttactcgctcgactcgctc
ttcatggagcctgccattctcaccactatggacataatccaggacggcttcggtatgatg
ttgtcattcggtgacctcgtctgggtgcccttcacctacaccatccaaacacgctacctc
tccgtctaccccgttgatctcggcatcaagggtatcgttgctgtgctcgccgtccagggc
ttcggctactacatcttccgctccgtcaacaacgagaagaaccgcttccgcaccaacccc
gaggaccctcgtgtctctcacctcaagtacatcgagactgaagctggctcgcgccttctc
atctccggatggtggggcatggcccgccacatcaactacctcggcgactggttcatgagc
tggtcctacgtcctgcccaccgctctgtccggctacttgatccgcaacgccgcgcagcat
cccatcaccgccgcgcaatctgacgcatacttcttcaaggacagctacggcaaatacgct
gtccctggtgaggccaagggctggggcatgatcttcacctacttctttatggtctacttc
gccgtccttctcttgcaccgtgaacgccgtgacgaggagaagtgcaggcgcaagtacggc
aaggactgggaccgctacgtcgagcatgtcccctacagaatcattccgtacgtgtactaa

DBGET integrated database retrieval system