KEGG   Parastagonospora nodorum: SNOG_04160Help
Entry
SNOG_04160        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
pno  Parastagonospora nodorum
Pathway
pno00010  Glycolysis / Gluconeogenesis
pno01100  Metabolic pathways
pno01110  Biosynthesis of secondary metabolites
pno01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SNOG_04160
Enzymes [BR:pno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     SNOG_04160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N Adeno_PIX
Motif
Other DBs
NCBI-GeneID: 5971453
NCBI-ProteinID: XP_001794585
UniProt: Q0UVQ4
Position
Unknown
AA seq 191 aa AA seqDB search
MFMAVVLVFLWQTAKPDALGRAQLRPSDYELALLDLVEDNELSWKGNPNELVASYAADGY
ARVNGAAAFITTFGPGELSAYCGMAGQYAEFVPVVHVVGYPTVNAVRICSMYQEMAKHIT
AATTVIDHVPSAASEIDRVLNTMMRESRPVYIGLSVDMAYETISGTPLDMPIVRSLPLND
PVLEANVISQI
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgttcatggctgtcgtgttggtcttcctgtggcagacagcgaaacccgacgcgctcggc
cgagctcagctccggccgtcagattatgaactagcactcctcgacctcgtagaagacaat
gagttgtcatggaagggcaacccaaacgaactcgtcgcatcctacgccgcggatggatac
gcacgtgtcaacggtgccgccgccttcatcaccacgttcggcccaggcgaactatctgct
tattgcggaatggctggccagtatgctgagtttgttccggtcgtgcatgtcgttggatat
ccgactgtcaacgctgtgaggatttgtagcatgtaccaggagatggcaaagcatattaca
gctgcgactacggtcatcgaccatgtcccgtctgcagcttcggagatcgatcgtgtgttg
aacacgatgatgagagagtcgagacctgtgtacattggcttgtcagtggacatggcgtac
gagacgatctctggaacgccacttgacatgccgattgtgcgatcgctgccgctcaatgac
ccagttctggaggcgaacgtgatctctcagatttga

DBGET integrated database retrieval system