KEGG   Parastagonospora nodorum: SNOG_04647Help
Entry
SNOG_04647        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K08794  calcium/calmodulin-dependent protein kinase I [EC:2.7.11.17]
Organism
pno  Parastagonospora nodorum
Brite
KEGG Orthology (KO) [BR:pno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pno01001]
    SNOG_04647
Enzymes [BR:pno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     SNOG_04647
Protein kinases [BR:pno01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   SNOG_04647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like YrbL-PhoP_reg Kdo
Motif
Other DBs
NCBI-GeneID: 5971929
NCBI-ProteinID: XP_001795061
UniProt: Q0UUB7
Position
Unknown
AA seq 372 aa AA seqDB search
MLNKLHGQPDSYDRKSRYRFGKTLGAGTYGIVREADCPEGKVAVKIILKKNVKGNEQMVY
DELEMLQRMKHPHIVKFHDWFESRDKYYIVTQLATGGELFDRICEKGKFTEKDAAETIRQ
VLEAVNYLHENNVVHRDLKPENLLYLTRDAHSSLVLADFGIAKMLDSKSEVLTTMAGSFG
YAAPEVMLKKGHGKPVDMWSMGVITYTLLCGYSPFRSENLADLIEECKNGRVVFHERYWK
EVSKEAKEFITLLLQPDPNKRPTSKVSGATASDHNLLPEIRAYVAKARLKRGIELVKLAN
RIEALKMQEDEEEDAPEETPDAGTGKGPGRLSRIAKGAIFREVVLAKVREMKEAEARAEF
EKKATESGTKKA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgctcaacaagctgcacggccagcccgacagctatgaccgcaaatctcgataccgcttc
ggaaagacactgggcgccggcacatatggcatcgtccgtgaggccgactgccccgagggc
aaggtcgctgtcaaaatcattctgaagaagaacgtaaaaggcaatgagcagatggtgtac
gacgagctggagatgttgcagcgcatgaaacacccacatattgtcaagttccacgactgg
ttcgagtcaagggacaagtactacattgtgactcaactggcaaccggcggagagctgttc
gaccgcatttgcgagaagggaaagttcactgagaaagacgccgccgagacgatcagacag
gtccttgaggcagtcaactacctccacgagaacaacgttgtgcacagagatctcaagccc
gagaatcttctctacctcacacgcgacgctcactcatcactcgtgctggccgactttggt
atcgccaagatgctcgactccaagagcgaagtcctcactacaatggctggatccttcgga
tatgctgcacctgaggttatgctgaagaaagggcacggaaagcctgtcgacatgtggtcg
atgggagtcatcacttacacacttctctgcggttactctccattccgatcagagaacctg
gccgatcttatcgaggagtgcaagaacggacgtgtcgtcttccacgagcgatactggaag
gaggtcagcaaggaagccaaggagttcatcacgttgctactacagccagacccaaacaag
cgacctacgagcaaggtaagcggcgcgacggctagtgaccacaacttgctgcctgagatt
cgcgcgtatgttgcaaaggcccgtctcaagcgcggtatcgagcttgtcaagcttgcgaac
cgcatcgaagcgctcaagatgcaagaggacgaagaggaggacgctccagaagaaactcct
gatgctggcactggaaagggacccggacgtctaagcaggatcgcaaagggagccatcttc
cgagaagtggttttggccaaagtacgagaaatgaaggaggcagaggcaagggccgagttc
gagaagaaggccaccgagagcggaaccaagaaggcttga

DBGET integrated database retrieval system