KEGG   Parastagonospora nodorum: SNOG_05286Help
Entry
SNOG_05286        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pno  Parastagonospora nodorum
Pathway
pno00450  Selenocompound metabolism
pno00970  Aminoacyl-tRNA biosynthesis
pno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SNOG_05286
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SNOG_05286
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pno01007]
    SNOG_05286
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pno03016]
    SNOG_05286
Enzymes [BR:pno01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SNOG_05286
Amino acid related enzymes [BR:pno01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SNOG_05286
Transfer RNA biogenesis [BR:pno03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SNOG_05286
 Prokaryotic type
   Other AARSs
    SNOG_05286
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 5972568
NCBI-ProteinID: XP_001795693
UniProt: Q0USH8
Position
Unknown
AA seq 559 aa AA seqDB search
MTEIKKKILPVEGERNVLITSALPYVNNVPHLGNIIGSVLSADVFARFARARGYNTLYVC
GTDEYGTATETKAIEEKVTPQQLCDKYFALHSEVYEWFNISFDHFGRTPTQHQTDIAQDI
FKKLYKNGYLEEQTTTQPYCETHKSFLADRFVEGTCPLCNYEDARGDQCDKCGHLLDPLE
LKNPRCKLDGATPVPRETKHVYLCLDKLQPKEEEWFKKASQEGNWSSNGIQITASWLKEG
LRPRGITRDLKWGTAVPLEKWWHNPEQVKLYQFMGKDNVPFHTVVFPCSQIGTGDKWTML
NTISTTEYLNYEKGKFSKSRNIGVFGNNAKDTGIPSDVWRYYLLSHRPETGDTEFEWDGF
IAANNNELLKNLGNFVNRVIKFVNSKHFTSRAKETQLLQDNRLDNKLATEHPERCAAVVG
LALSHIHLLASLIQPYMPDTTASILSQLNAEFLIIPDDWEARSLPVGHKIGTAGYLFSQI
KPEKEQEWREQFGGEEARKAKEEKARKAAAKKAEKERKKAKKANAQGVEAAEKGQDGPAK
KTAEEEVTRGVEQVSLQTS
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagatcaagaagaaaatcctgcccgttgagggcgagcgcaatgtgctcatcacg
agtgcgctgccatacgtcaacaatgtcccgcatttaggcaacatcatcggaagtgttctg
tcggcggatgtctttgcccgttttgcgcgcgcacgaggatacaacacactatatgtctgc
ggtactgacgagtacggaaccgcgaccgagacgaaggcaattgaggagaaggtcacacca
caacagctatgcgacaagtattttgcgctgcactcggaagtctacgaatggttcaacatc
agcttcgaccactttggacgcacaccgacccagcaccaaaccgatattgctcaagacatc
ttcaagaagctgtacaagaacggctatctggaagagcagaccacaacacagccgtactgt
gagacacacaagagctttctggcagatcgatttgttgaaggcacatgtccgctatgcaac
tacgaagacgcccgaggtgaccaatgcgataaatgtggacatcttctagatcctctcgag
ctcaagaatcctcgttgcaagctcgacggagccacaccggtaccgcgcgagactaaacac
gtctacctatgtctggacaagctacagccgaaagaggaggagtggttcaagaaggcgagt
caggagggcaactggagttccaatggtattcaaatcacggcatcttggttgaaggagggt
ctcagacctcgtggcatcacgcgtgacttgaagtggggtactgctgtaccactcgagaag
tggtggcacaaccccgagcaggtcaagctctaccagttcatgggcaaggacaacgtaccg
ttccacacagtcgtcttcccctgttcacaaattggcaccggcgataagtggactatgcta
aacacgatttcgacgaccgagtacctcaactacgagaagggcaagttctcaaagtcaaga
aacattggtgtcttcggaaacaacgcaaaagacactggtatcccctccgacgtctggcgc
tactacctcctctctcatcgaccggagactggtgacaccgaatttgagtgggacggcttc
attgctgcgaacaacaacgagctcctcaagaacttgggcaacttcgtcaaccgcgttatc
aagtttgtcaactccaagcacttcacgtctcgagccaaggaaactcaactactccaagac
aaccggttggacaacaagctagcaaccgagcacccagagcgctgcgccgccgtcgtcgga
ctagctttgagccacatccacctcctcgccagtctgatccagccatacatgcccgacacc
accgcctccatactctcccaactcaacgccgaattcctcatcatccccgacgactgggaa
gcccgctcgcttcccgtcggccacaagatcggaaccgccggctatctcttctcgcaaatc
aagcccgagaaggagcaagagtggcgcgagcagttcggcggcgaagaagcgcgcaaggcg
aaggaggagaaggcccgcaaagctgcggccaagaaggcggagaaggagcgcaagaaggcg
aaaaaggcgaatgcgcagggcgtcgaggctgcggagaagggacaggatgggccggcgaag
aagacggctgaggaggaggttacgcggggagtggagcaggttagtctgcagacgtcgtag

DBGET integrated database retrieval system