KEGG   Parastagonospora nodorum: SNOG_20064
Entry
SNOG_20064        CDS       T01161                                 

Gene name
SNOG_06023
Definition
(RefSeq) hypothetical protein
Organism
pno  Parastagonospora nodorum
SSDB
Motif
Pfam: Trypan_glycop Pyr_redox_2
Other DBs
NCBI-GeneID: 5973288
NCBI-ProteinID: XP_001796411
UniProt: A9JX55
Position
Unknown
AA seq 92 aa
MAGTEPIITQGIEPSSGESHSPPGERHVSATWGSKDGNISNAEWNDPEANKLPEKVAELE
KKGEINQDGQRKKIVVVGLGMVGIAFMCVLRC
NT seq 279 nt   +upstreamnt  +downstreamnt
atggcggggactgagcccattatcacacagggcattgagccatcgtcgggcgaatcgcat
tcgccgcctggcgaacgccatgtctcagcaacatggggatcaaaagacggcaatatttcc
aacgcggagtggaatgacccagaggcgaataaactgcctgaaaaagtagcggagttggag
aagaagggcgagatcaaccaggatggccaacggaaaaagattgttgttgttgggctggga
atggttggtattgcgttcatgtgcgtcctcagatgttga

DBGET integrated database retrieval system