KEGG   Parastagonospora nodorum: SNOG_06409Help
Entry
SNOG_06409        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
pno  Parastagonospora nodorum
Pathway
pno00500  Starch and sucrose metabolism
pno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SNOG_06409
Enzymes [BR:pno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     SNOG_06409
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_6 CBM_1
Motif
Other DBs
NCBI-GeneID: 5973660
NCBI-ProteinID: XP_001796781
UniProt: Q0UPA5
Position
Unknown
AA seq 449 aa AA seqDB search
MKAVSFLAVAALAPAIKAQASLYQQCGGTGFSGSTTCVSGAYCSKVNDSATSAAPAPTTF
KTSKTVGSPATGSSTTGSSATGTASPGDGSNPLKGKNFYANSYYASEINNLAAPSLVAAG
NAALAAKASNVAKVGTFYWLDVRAKVPIISTFAKDVQKRNAAGANEVLPLVVYDLPERDC
AALASNGELSLANNGTALYQEYIDMIAAQIKQFPDVTFLLVVEPDSLANLVTNLNVAKCA
NAATAYKTLTAYAIKTLNLKNVIMYLDAGHAGWLGWTANIEPAAELFGALYKSAGSPAAV
RGLVTNVANYNAWSIATCPSYTQGNTNCDEKRYVNALAPLLVKNGFPAHFLTDTGRNGVQ
PTKQQAWGDWCNVIGTGFGIRPSSTTDDPLLDAYVWVKPGGEGDGTSDTSAVRYDAHCGY
ADALKPAPEAGSWFQAYFVQLLSNASPAF
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgtttctttcctcgctgttgccgctctggctccagctatcaaggcccaggct
agtttgtaccagcagtgtggtggcactggcttttctggaagcacaacttgcgtttcaggc
gcatactgctctaaggtcaacgactctgctacatcggctgctcctgccccaacaacattc
aagaccagcaagactgttggcagcccagccactggatcttcgactaccggaagctcggcg
acagggactgcttccccaggcgatggctcaaacccgctcaagggcaaaaacttctacgcc
aactcgtactacgcctctgagatcaataacttggcagctccatctctggtcgctgctgga
aatgctgctttggctgccaaagccagcaatgtggctaaggttggcaccttttactggctc
gatgtccgtgcgaaggtccccatcatcagcactttcgccaaggacgtgcagaagcgcaac
gcagccggtgccaacgaggtcttgccgctcgtagtctacgacttgcctgagcgcgactgt
gccgctctggcttcaaacggtgaattgtcgctggccaacaacggcactgccttgtaccag
gagtacattgacatgatcgcggcccagatcaagcaattccccgatgtcaccttcctcctt
gtcgttgaacccgattctctggccaacctggtgaccaacctgaacgttgccaaatgcgca
aacgccgcgaccgcatacaagacactcaccgcatacgcaatcaagacactcaacctgaag
aacgtgatcatgtacctcgatgccggtcatgcaggctggctcggctggactgcgaacata
gagcctgccgccgaactcttcggagcgctctacaagtccgcgggatccccagcagcagtg
cgcggtctcgttaccaacgtcgccaactacaacgcctggagcattgccacatgtccttct
tatacccaaggcaacaccaactgtgacgagaagagatacgtcaatgcgctcgctcctttg
ctcgttaagaatggcttccctgctcatttccttactgacaccggtcgcaacggcgtgcag
cccaccaagcaacaagcctggggcgattggtgcaacgtcatcggcaccggctttggtatc
cgacccagctctacgactgacgacccattgctcgacgcatacgtctgggtcaagcccggt
ggtgaaggcgatggtacctccgatacaagcgctgtacgatacgatgcgcactgcggatac
gcagatgcactgaagcctgcgcctgaggctggatcatggttccaggcatactttgtgcag
cttctgagcaacgcaagccccgcattttaa

DBGET integrated database retrieval system