KEGG   Parastagonospora nodorum: SNOG_06608Help
Entry
SNOG_06608        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K01210  glucan 1,3-beta-glucosidase [EC:3.2.1.58]
Organism
pno  Parastagonospora nodorum
Pathway
pno00500  Starch and sucrose metabolism
pno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SNOG_06608
Enzymes [BR:pno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.58  glucan 1,3-beta-glucosidase
     SNOG_06608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cellulase Glyco_hydro_42
Motif
Other DBs
NCBI-GeneID: 5973853
NCBI-ProteinID: XP_001796974
UniProt: Q0UNQ6
Position
Unknown
AA seq 427 aa AA seqDB search
MQLPLSFTAILAATSTLVNAAPANDLHERRVDFNWGSNKVKVRGVNLGGWLVLESFITPS
IFESHSSDNWPIVDEWGLCEKVGQQNCADVLKPHWDSFVTLDDFWKIKNAGFNMVRIPVG
YWSYVNPWGPYAQGAAPYLDAAIDWARQTGLKVVIDLHGAPKSQNGFDHSGHRASVPGWG
DADSLGYTHAALRIIEEKYAIPSMQDVVVSIQPLNEPFLLKLDKEMVKNFYRDAYYNLRE
ISDMPIMFHDGFEVPSWMNGFLTPQDNNAQNVIVDHHEYQIFDKDLLAFSVEQHLGLMCD
SANNLHSSDKWTIVGEWSGALTDCAKHVNGFAAGHRYDGSYPDTHYIDTCTGKSGLVSTW
TQEWKDNIRRYIEVQLDAYEANTMGWVFWNFKTEGSAGDWDLFQLLDGGVFPQPLSDRKF
PRWCKNF
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgccactctcgttcacagccatattggccgctaccagtacccttgtgaacgca
gcacccgcaaatgacctccacgagcgacgtgtcgatttcaattggggcagtaataaggtc
aaggtccgtggcgtcaatctaggcggttggttggtccttgagtcgttcattacaccttcc
atcttcgagagtcatagctcggacaactggcccatcgtcgatgagtggggactgtgtgag
aaggtcggccaacagaactgtgccgatgtcctcaagcctcattgggacagctttgtgacg
cttgacgacttttggaagatcaagaacgctggcttcaatatggtccgcattcccgtgggc
tactggagctacgtcaatccatggggaccgtatgctcaaggtgccgccccgtacctggat
gctgcaatcgactgggcgcgacagactggcttgaaggtggtgatcgatctccacggcgca
cccaaatctcagaacggctttgatcattccggtcacagggcctctgttcctggttggggc
gatgccgacagtcttggctacactcatgctgcacttcgtattatcgaggagaagtatgct
ataccatcgatgcaggatgttgtcgtctcgatccagccgctcaacgagcctttcttgctc
aagctggacaaggagatggtcaagaacttctaccgcgatgcttactacaaccttcgcgag
atcagtgatatgcccatcatgttccacgatgggttcgaagtcccgagctggatgaacggc
ttcctcacaccgcaggacaacaacgcacagaatgtgattgtcgatcatcacgagtaccag
atcttcgacaaggaccttctagcattttcggtcgagcagcatcttggcctcatgtgcgat
tccgccaacaacctccatagctccgacaagtggaccatagtcggcgaatggtccggcgcc
ctcaccgactgtgccaaacacgtcaacggcttcgctgcaggccaccgctatgacggcagc
taccccgacacccactacatcgacacatgcaccggaaaatccgggcttgtatccacctgg
acgcaagaatggaaggacaacatccggcgctacattgaagtgcaactcgacgcgtacgag
gcgaacaccatgggttgggtcttttggaacttcaagactgagggcagcgcgggcgattgg
gatctctttcagctgctggatggaggtgtgtttccgcaacccctttcagataggaagttt
cctaggtggtgtaagaacttttag

DBGET integrated database retrieval system