KEGG   Parastagonospora nodorum: SNOG_07066Help
Entry
SNOG_07066        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K15435  2',3'-cyclic-nucleotide 3'-phosphodiesterase [EC:3.1.4.37]
Organism
pno  Parastagonospora nodorum
Brite
KEGG Orthology (KO) [BR:pno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pno03016]
    SNOG_07066
Enzymes [BR:pno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.37  2',3'-cyclic-nucleotide 3'-phosphodiesterase
     SNOG_07066
Transfer RNA biogenesis [BR:pno03016]
 Eukaryotic type
  tRNA spricing factors
   Other tRNA splicing factors
    SNOG_07066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPDase 2_5_RNA_ligase2 Integrin_b_cyt
Motif
Other DBs
NCBI-GeneID: 5974310
NCBI-ProteinID: XP_001797420
UniProt: Q0UME8
Position
Unknown
AA seq 193 aa AA seqDB search
MPGSSLWLLPPKSHRLNSILPTLIDQTSSHFGSAHRFLPHVTITSEISPSTHSPNPQAWL
DSLEISSGDKIEVMFEKLASEDVFFRKLYIKCHKTEGLKKLAVLCRREVEGFGEEREAAK
WATESYNPHLSLLYHDCPSIDASGLAEIEKLAQSTGVNLNGQSDLGGWSGGRLVLVPTDK
SIDQWSPIAEREL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgccgggctcatctctgtggctacttccgcccaaatcgcaccgtctcaactcgatactt
cccaccctgattgatcaaacctcatcacacttcggatctgctcaccggttcctgccgcac
gtcaccatcacttcggagatatcaccatccacacattcacccaatcctcaagcctggctg
gattcactagaaatctcatcaggcgacaagattgaggtcatgttcgaaaagctggctagc
gaagatgtgtttttccgaaagctttatatcaaatgccacaagactgaaggactgaagaag
ctagctgtgctttgtcggcgggaagtggaggggtttggggaagagagagaggccgctaaa
tgggcgactgaatcgtacaatccgcatttgagcttgctttatcacgattgcccatcaatc
gacgcaagtggactagctgagatcgaaaagttggcccagagcactggagtcaacctcaac
gggcagagtgacttgggtggctggagtggaggtagattggttttggttcctaccgataag
tccatcgatcagtggtctccgattgctgagagagagctatga

DBGET integrated database retrieval system