KEGG   Parastagonospora nodorum: SNOG_07359Help
Entry
SNOG_07359        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K01694  tryptophan synthase [EC:4.2.1.20]
Organism
pno  Parastagonospora nodorum
Pathway
pno00260  Glycine, serine and threonine metabolism
pno00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pno01100  Metabolic pathways
pno01110  Biosynthesis of secondary metabolites
pno01130  Biosynthesis of antibiotics
pno01230  Biosynthesis of amino acids
Module
pno_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SNOG_07359
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SNOG_07359
Enzymes [BR:pno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SNOG_07359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_syntA PALP Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 5974589
NCBI-ProteinID: XP_001797696
UniProt: Q0ULK5
Position
Unknown
AA seq 734 aa AA seqDB search
MDGIKKTFAQCKKEGRSALVTYVTAGYPTKQATADIMLGMEAGGAAEVVKTHQLTFADII
ELGMPFTDPIADGPTIQTANTQALKNGINTGDVLQMIRDARKRGLKAPVLLMGYYNPLLS
YGEERMLQDAKEAGANGFIMVDLPPEEALRFRNFCRSYGLSYVPLIAPATSEHRMRVLCK
IADSFIYVVSRMGVTGASGTMNAALPQLLERVHKYSGNIPAAVGFGVSTRDHFVSVGKIA
EGVVIGSQIINTIAQAGEGKEAEAVQKYCDMICGKSSRATTREVGIVETLAEAKEPTGVH
VDKVITDADTPDGPGLADQLEALNTGSDGFDEDHAHPPRFGEFGGQYVPESLMDCLSELE
KGFSAAIDDPKFWEEYRSYYDWMGRPGHLHLAERLTEHAGGANIWLKREDLNHTGSHKIN
NALGQVLVARRLGKTEIIAETGAGQHGVATATVCAKFNMKCTIYMGAEDVRRQALNVFRI
KLLGASVVAVEAGAQTLRDAVNEAMRAWVVHLDTTHYIIGSAIGPHPFPTIVRTFQSIIG
NETKQQMQEKRGKLPDAVVACVGGGSNAVGMFYPFSKDPSVKLLGVEAGGDGIDTERHSA
TLSAGTKGVLHGVRTYVLQNKHGQISETHSVSAGLDYPGVGPELASWKDNDRAKFIACTD
ADAFKGFRILSQLEGIIPALETSHAVFGAIELAKTMGKDQDIVICVSGRGDKDVQSVAEE
LPKLGPKIGWDLRF
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atggacggcatcaagaagacattcgcccaatgcaagaaggagggccgttcggccctcgtc
acatatgtgactgcaggctaccccaccaagcaggcgacggctgatatcatgctgggaatg
gaggctggcggtgccgcggaagtggttaagacgcatcaattgactttcgcagacatcatc
gagcttggcatgcccttcaccgaccccatcgccgacggccccaccatccagactgcgaac
actcaagcgctcaagaacggcatcaacacaggggatgtgttgcagatgatccgcgatgcg
cgaaagcgcggccttaaggcaccggtcttgcttatgggatactacaaccccttgttgagc
tacggcgaggaacgcatgctccaggatgctaaggaggctggtgccaacggcttcatcatg
gtcgatcttccacctgaggaggctctgcgcttcaggaacttctgccgcagctatggtctc
tcctacgtccctcttatcgcacctgctacctcggaacaccgtatgcgcgtcctttgcaag
attgccgattccttcatctacgtcgtatcgcgcatgggggtcactggcgcatctggaaca
atgaatgctgcgctcccccaactgctcgagcgagtacacaagtattctggcaacattcct
gctgcggtcggattcggtgtcagcacacgagaccacttcgtgagcgtcggaaagatcgca
gagggtgtagtcattggaagccagattatcaacaccattgcccaggctggcgaaggcaaa
gaggcggaagcagttcagaaatactgcgacatgatttgcggcaagagtagtcgtgcgacc
acgcgcgaggtcggcattgttgagactctggcagaggccaaggagcccaccggtgttcat
gtcgacaaggtcatcacagacgctgacacgcctgatggtcccggccttgctgaccagctc
gaggcgctgaacactggctccgatggattcgacgaggaccatgcgcatccgcctcgattt
ggcgagttcggtggccagtatgtgcctgaatcccttatggactgtctctccgaactcgaa
aagggcttcagcgccgcaattgacgatccgaaattctgggaagagtacaggtcctactac
gactggatgggccggccagggcatctgcatctggcagagcgccttacggaacatgctggc
ggtgcaaacatctggttgaaacgcgaggatctcaaccatactggaagtcacaagatcaac
aatgcgcttggccaggtcttggttgctcgcagacttggaaagacggagatcatcgcagaa
acaggagccggccagcacggtgttgcaactgccacagtctgcgccaaattcaacatgaag
tgcaccatttacatgggtgctgaggatgtcaggcgccaggcgctcaacgtcttccgtatc
aagttgcttggcgcttcggtcgttgctgtcgaggctggcgcgcagaccctacgtgacgct
gtcaacgaggctatgcgtgcttgggttgtacacctcgacacgacccactacatcattgga
tctgctatcgggcctcatccgttccctacgattgtccgtaccttccagtccatcatcgga
aacgagacgaagcagcagatgcaggagaagcgtggaaagctccctgacgcggttgttgct
tgtgttggcggtggcagcaacgctgtcggcatgttttacccgttctctaaggacccgtct
gtcaagctacttggtgtagaggctggtggtgatggcatcgatactgagcgccacagcgcc
acgctctctgctggtaccaagggcgtgctccacggtgtgcgcacctatgtcctccagaac
aagcacggacagatcagcgagacgcactctgtctctgcaggcctcgactaccctggtgtt
ggtcctgaacttgccagctggaaggataacgatcgcgccaagttcatcgcttgcactgat
gccgatgctttcaagggcttccgtatcctctcgcagttagagggtattattccagcgctc
gagacatcccacgctgtctttggcgccattgagttggcgaagaccatgggcaaggaccaa
gatattgtcatttgcgtctcaggccgtggtgacaaggatgtccagagcgttgctgaggag
ctacccaaacttggacccaagattggctgggatttgaggttctga

DBGET integrated database retrieval system