KEGG   Parastagonospora nodorum: SNOG_08115Help
Entry
SNOG_08115        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K03144  transcription initiation factor TFIIH subunit 4
Organism
pno  Parastagonospora nodorum
Pathway
pno03022  Basal transcription factors
pno03420  Nucleotide excision repair
Module
pno_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:pno00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    SNOG_08115
  Replication and repair
   03420 Nucleotide excision repair
    SNOG_08115
Transcription machinery [BR:pno03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     SNOG_08115
DNA repair and recombination proteins [BR:pno03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     SNOG_08115
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tfb2 Helicase_C_3
Motif
Other DBs
NCBI-GeneID: 5975338
NCBI-ProteinID: XP_001798440
UniProt: Q0UJE9
Position
Unknown
AA seq 426 aa AA seqDB search
MAMLYMPSSFPAADLEAWFKPSARSERVQALDILERLHILGSKREDDKSLSYSLIPGFQR
SLRHAIEGSGTHRTFGVPASKAERGEKRLSIEFLDAHAREQWEGILFFMVSGAAGFQPGS
VKMDVGPGTKKLLHAGDLVRTVHGTPRITKEGFSFVLQETNAQVWNLLIVYLKMVDDLGM
SETEVLSFLFMLGSLELGQDYSTSTLSPSQLHMLDDLSAMGIVYRSSKDSPTFYPTRLAT
TLTSDSGALPGSDVGTTEKPDSKAQNKGFIIVETNYRLYAYTNSLIQIAILSLFTKLQHR
FPNLVSGKLTKESVHRAVQAGITSAQIISYLTTYAHPQMQKSNPPLPPTVMDQIRLWEYE
GERVEVTTGYLMREFGSESEYRDVMGYAQALGVLVWKNDANRCFFVSHVEQVAGYLKKKK
EGKGGR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgctctacatgccctcgtcttttcccgccgccgatctcgaagcctggttcaag
ccctcggcgcgtagcgaacgtgtacaagcccttgatattctcgaacgcctgcatatcctc
ggttcgaaacgggaagacgataagagcttgtcgtactcgctcattccggggtttcagcgt
agcttgcgccatgccatcgaagggtcgggcacgcatcgcacgtttggtgtgccggcgtcg
aaggccgagagaggggagaagaggcttagtattgagtttctggatgcgcatgcaagagag
cagtgggagggcatattgttcttcatggtcagcggagctgcagggttccagccagggagc
gtgaagatggacgtcgggcctgggacgaagaagctgttacatgcgggagatctggtcagg
acagtgcatgggacaccgagaatcactaaggagggattcagcttcgtgctgcaggagacg
aatgcccaggtgtggaatctgctgatagtatacctcaagatggtcgacgatctgggcatg
tcagagaccgaagtcctctccttcctcttcatgctcggctccctcgaactcggccaggac
tactctacttcgaccctctctcccagtcaactccacatgctcgacgacctctctgccatg
ggcatcgtctaccgcagctccaaagactcacccacattctaccccacccgcctcgctacc
accctgacatccgactccggcgccctccccggctcagacgtcggcaccacggagaagccc
gacagcaaggcccaaaacaagggcttcatcattgtcgagaccaactacagactctacgca
tacacaaacagtctgatccagattgccatcctcagcttgtttaccaaactccaacatcga
tttcctaacctcgtctccggcaagctcacaaaggaatccgtccatcgcgccgtccaagca
ggcatcacgtccgcgcaaatcatctcctacttaaccacctacgcccatccgcagatgcaa
aaatctaacccgcccttgccacctaccgtcatggaccagatccgcctgtgggagtacgaa
ggcgagcgtgtcgaagttaccacgggctatttgatgcgggagtttgggtcggagagcgag
tatagagatgtgatgggctatgcgcaggcattgggcgtgctggtgtggaagaatgatgcg
aatagatgcttttttgtcagtcatgtggagcaggtggcggggtacttgaagaagaaaaag
gagggcaagggagggaggtag

DBGET integrated database retrieval system