KEGG   Parastagonospora nodorum: SNOG_09416Help
Entry
SNOG_09416        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
pno  Parastagonospora nodorum
Pathway
pno00030  Pentose phosphate pathway
pno00480  Glutathione metabolism
pno01100  Metabolic pathways
pno01110  Biosynthesis of secondary metabolites
pno01130  Biosynthesis of antibiotics
pno01200  Carbon metabolism
Module
pno_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pno_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:pno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SNOG_09416
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SNOG_09416
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pno04147]
    SNOG_09416
Enzymes [BR:pno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     SNOG_09416
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     SNOG_09416
Exosome [BR:pno04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SNOG_09416
  Exosomal proteins of colorectal cancer cells
   SNOG_09416
  Exosomal proteins of bladder cancer cells
   SNOG_09416
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 5976611
NCBI-ProteinID: XP_001799710
UniProt: Q0UFP8
Position
Unknown
AA seq 492 aa AA seqDB search
MELKDNTIIVVLGASGDLAKKKTFPALFGLHRNNFLPKNIRIVGYARTKMDHEEYLKRVK
SYIKTPTKELEKQLEEFCGFCTYVSGQYDKDESFQELEKHLQDLEKGRKETNRIFYMALP
PSVFITVSQHLKRNCYPKNGISRVIVEKPFGKDLPSSRELQTALAPDWTEDELYRIDHYL
GKEMVKNILILRFGNEFFGATWNRNHIDNIQITFKEPFGTEGRGGYFDEFGIIRDVMQNH
LLQVLTLLAMERPISFSAEDIRDEKVRVLRGMAAIEPKNVIIGQYGKSLDGTKPGYKEDD
TVPKDSRCPTFASMVAYIKNERWDGVPFILKAGKALNEQKTEVRIQFKDVTSGIFKDIPR
NELVIRVQPNESVYIKMNSKLPGLSMQTVLTELDLTYRRRFSDLKIPEAYESLILDALKG
DHSNFVRDDELDASWRIFTPLLHYLDDNKEIIPMEYPYGSRGPAVLDDFTSSYGYKFSDA
AGYSWPMNEQKL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggagctcaaggacaacaccatcatagtcgttctaggcgcgtccggcgatctggcaaag
aagaagactttccctgcgctcttcggccttcaccgcaacaacttcctccccaagaacatt
cgcatcgtcggatatgcacgaacgaagatggaccacgaggagtacctcaagcgcgtcaag
tcgtacatcaagacccccacaaaagagcttgagaagcaactcgaggagttctgcggcttc
tgcacatatgtatctggccagtatgacaaggatgagtccttccaggagctcgagaagcac
ctccaagacctcgagaagggtcgcaaggagaccaacaggattttctacatggcgctccct
cccagcgtcttcatcacagtctcgcagcacttgaagcgcaactgctacccaaagaacggc
atttctcgtgttatcgtcgagaagcccttcggtaaagatcttcccagctcccgagagctt
cagactgcgctcgcaccagactggaccgaagatgagctctaccgtatcgatcactacctg
ggcaaggagatggtcaagaacatcctcattctccgattcggcaacgagttctttggcgcc
acatggaacaggaaccacatcgacaacattcagatcacattcaaggagccttttggcaca
gagggacgaggaggctactttgacgagtttggcatcattcgtgacgttatgcaaaaccat
ttgttgcaagtcctcaccctcctcgccatggagcgaccaatctccttctccgccgaagac
atccgtgacgagaaggtccgcgttcttcgtggcatggccgcgatcgagccaaagaacgtg
atcattggccagtacggaaagtcccttgacggcacgaagcccggctacaaggaggatgac
actgtccctaaggactctcgatgccctacctttgcctcgatggtcgcatacatcaagaac
gagaggtgggatggtgtacctttcattctgaaggcaggaaaggcccttaacgagcagaag
accgaggtgcgcatccaattcaaggatgtcacttcaggcatcttcaaggacattccccga
aacgagcttgtcattcgcgtacagccgaacgagagtgtgtacatcaagatgaactcgaag
ctgcccggtctcagcatgcagactgttctcacagagctcgatctcacctacaggcggcgc
ttctccgatttgaagatcccagaggcctacgaatcactcattttggatgcgctcaagggt
gaccactccaactttgtccgtgacgatgagctcgatgccagctggaggatcttcactcct
ctgctacactacctcgatgacaacaaggagatcattcctatggagtacccttacggatct
cgcggccctgccgtgcttgacgacttcacctcatcttacggctacaaattcagcgacgca
gcaggctactcatggcccatgaacgagcagaagctgtaa

DBGET integrated database retrieval system