KEGG   Parastagonospora nodorum: SNOG_10117Help
Entry
SNOG_10117        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
pno  Parastagonospora nodorum
Pathway
pno00220  Arginine biosynthesis
pno00330  Arginine and proline metabolism
pno01100  Metabolic pathways
pno01110  Biosynthesis of secondary metabolites
pno01130  Biosynthesis of antibiotics
pno01230  Biosynthesis of amino acids
Module
pno_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    SNOG_10117
   00330 Arginine and proline metabolism
    SNOG_10117
Enzymes [BR:pno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SNOG_10117
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase P2
Motif
Other DBs
NCBI-GeneID: 5977306
NCBI-ProteinID: XP_001800400
UniProt: Q0UDP7
Position
Unknown
AA seq 294 aa AA seqDB search
MSANSITVIFSPYHVGLRDHRVGDGPNRIRAMGVIEELKKLGVTIHVVELPPVDDFEGEI
GRSFELLRRTSKVVSDVCANRSFPLVLSGNCMASAGVACGLGLKDLGWIYFDAHDDMDTP
STNMNGYLDAMGLSMLGGKSFHRLANTIPGYTPHKYDKMIYCGLRDIEDSQKETVREAGA
EVIWGEPGKHVDFASRLTEALSAKDYSPALVHLDLDVLDESIGKVNGYESPGGLQEDDLI
KCMDLVPQKATPKSLTVCSFNPNLGDGDKVATIGVKAIVAFVKSLLKSEALVRE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaaattctatcactgtcatcttttcaccctatcatgttggccttcgtgatcac
cgtgtcggtgacggcccgaaccgcattcgagcaatgggtgtcatcgaagaattgaaaaag
ctcggcgtaactatacacgttgttgagctgccaccggttgatgattttgaaggggagata
ggtcgcagctttgagttactccggcggacgtctaaggtggtgtcagatgtgtgcgccaat
cgttcctttcctcttgttttatcgggaaactgtatggcaagcgctggagttgcttgtggg
ctgggcctcaaggatcttggctggatctactttgatgcgcacgacgatatggacacacca
tcaacgaacatgaacggatacttggatgcgatgggcctgtcaatgctaggtgggaaaagc
ttccatcggttggcaaatactattcctggatacactccgcacaagtacgacaagatgatc
tactgcggccttcgcgatatcgaggatagtcagaaggagactgtgcgagaggctggagcg
gaggtcatctggggagaaccaggcaaacacgtggactttgcgagtaggctcacggaagct
ctgagtgcaaaggactattcgcccgctttggtccatcttgaccttgatgttttggatgaa
agcatcgggaaggtcaatggttatgagagcccaggaggtttgcaagaggatgacttgata
aagtgtatggatctcgtcccgcagaaagctaccccaaaatccctcacagtctgttcattc
aatcccaacttgggagatggcgataaagtcgctaccattggtgtaaaggccatcgtcgcc
tttgtcaagtcgctcctcaaatccgaggctttggttagggaatag

DBGET integrated database retrieval system