KEGG   Parastagonospora nodorum: SNOG_12636Help
Entry
SNOG_12636        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
pno  Parastagonospora nodorum
Pathway
pno00330  Arginine and proline metabolism
pno00332  Carbapenem biosynthesis
pno01100  Metabolic pathways
pno01130  Biosynthesis of antibiotics
pno01230  Biosynthesis of amino acids
Module
pno_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SNOG_12636
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SNOG_12636
Enzymes [BR:pno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SNOG_12636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-GeneID: 5979767
NCBI-ProteinID: XP_001802856
UniProt: Q0U6H8
Position
Unknown
AA seq 521 aa AA seqDB search
MAVHMRKLPGQLTVVIKLGNYSNNENNLPTRAGTSSIVDEKTHQPLLSILSLIVETACKL
HADGHRVVIVSSGAIGVGLRRMNLPRRPKHLPQVQALAAIGQCRLMSLWDQLFGNLNQPI
AQVLLTRNDIADRTQYQNAQNTFIELLSMGVIPIVNENDTLAVTEIKFGDNDTLSAITAG
MVQADYLFLMTDVDCLYDKNPRSNPDAKAIEVVEDIAELAADVSSAGSSLGTGGMSTKIV
AARLATSAGVTTIITKSSKPGNIGAIMRHAEQERKKGMSSRNSTSNLQDHNDGVPLAQTA
ALNLHNSNHDLSASTSSLDQAPLSPSLHADSDTVPLHTRFLPISHPIRDRYFWILHGLAP
HGTIYIDQGAWNALNDKAGLLPVGIVDVDGHFAQQEAVRIVVVKRLPKSSPKSLPTTPAA
SSHGVHAPIPMRHPLPHSSSSYAREEGPRPYELHNPAPMEIGRAVVNYSAVEIRRIMGLH
STQIREALGYADSEYVALRENIAFTGRERSRPSTPDHRLEN
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggccgttcacatgcgaaagctgcccggccagctcaccgtcgtcatcaaactcggtaac
tactcaaataacgagaacaacttaccaacacgcgcaggaacctcttccatagtcgacgaa
aaaacgcaccagcccctcctctccatcctctccctcatcgtcgaaacagcatgtaaactg
cacgctgatggccaccgcgtcgtcattgtctcgtcgggcgccattggcgtgggtctcagg
cgcatgaacctaccgcgacgaccgaaacatcttccccaggtacaggcgcttgctgcgatt
gggcaatgtcggctgatgtcgctgtgggatcaattgtttggcaacttgaaccagccgatt
gcgcaggtgctgcttacaagaaatgacattgcagaccggacgcagtatcaaaatgcacag
aacacgtttattgaactgctaagcatgggcgttataccgattgtgaatgagaacgacaca
ttggcggtcacggagatcaaattcggagacaacgatacgctgagtgcaatcacggcggga
atggtacaggccgactatctgttcttaatgacggacgtcgattgcctgtatgacaagaac
cctagaagcaatccagatgcaaaggctatcgaggtcgtggaagacatcgctgagttggca
gcggacgtgagctcagcagggagctccttggggacaggcggcatgagcaccaagatcgtg
gcagcgcgattggcgacgagtgcaggtgtaacaaccatcataacaaagagcagcaagcca
gggaatatcggcgccatcatgagacacgcagagcaagagcggaagaaaggcatgtccagt
cgcaattccaccagcaaccttcaagaccacaacgacggcgtcccactcgcccaaaccgca
gctctaaacctccacaactcaaaccacgacctctctgcatcgaccagctccctcgaccaa
gcccccctctccccatcactacatgcagactccgacaccgtccccctccacacccgcttc
ctcccaatctcccaccccatccgcgaccgctacttctggatcctacacggcctcgcgccc
cacggcacaatctacatcgaccaaggcgcgtggaacgcactgaacgacaaagccggcctc
ctccccgtcggcatcgtcgacgtcgacggccacttcgcccaacaagaagccgtgcgcatc
gtcgtcgtcaagcggctccccaaatcttcaccaaaaagccttcccaccacacccgccgcg
tcttcccacggcgtgcacgccccgattcccatgcgtcacccattgccgcactcgtcatct
tcatatgcccgcgaagaagggcccaggccgtatgaattgcacaacccggcgccgatggag
attggccgcgcggtggtgaattactcggcggtcgagatcaggaggatcatggggctgcat
tcaacgcagattcgcgaggcgctggggtatgcggatagcgagtatgtggcgttgagggag
aatattgcgtttacggggagggagaggagtaggcccagtacgccggatcatcggttggaa
aattag

DBGET integrated database retrieval system