KEGG   Parastagonospora nodorum: SNOG_12666Help
Entry
SNOG_12666        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
pno  Parastagonospora nodorum
Pathway
pno00051  Fructose and mannose metabolism
pno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SNOG_12666
Enzymes [BR:pno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     SNOG_12666
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N UDPG_MGDP_dh_N FAM86 F420_oxidored Drf_DAD
Motif
Other DBs
NCBI-GeneID: 5979798
NCBI-ProteinID: XP_001802887
UniProt: Q0U6E8
Position
Unknown
AA seq 390 aa AA seqDB search
MPYDKKAVHFGGGNIGRGFVAEFLHNSGYEVVFVDVMDSIIEALQKQSSYTVTEIGDDGE
REFTIDHYRALNSKHEMDKVVQEIASADVVTCAVGPNILKFVAEPVAKAIDARTLDYPIA
VIACENAINATTTWRGFIEGKLSEDSKSNLDKKARFANSAIDRIVPVQDKDAGLNVKIEK
FYEWCVEQKPFENGGKKPDVKGIHYVDDLEPYIERKLFTVNTSHATAAYYGHQAKKQYIH
EVLQDKKLHDIVRDAVKETAHLIVSKHGVSVQEQNDYVDSIIKRISNPVLKDNVERVGRA
PLRKLSRKERFVGPAAQLAERGEKVDALLGAIEQAYLFQNVEGDEESAELAKILKENSAE
EVVTKVNGLDKSHPLFEKILPIVKKVQGGS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgccttacgacaagaaggctgttcacttcggcggtggcaacatcggccgtggcttcgtt
gccgagttccttcacaactctggctacgaggtcgtgttcgtcgatgtcatggacagcatc
attgaggctctccagaagcagtcgtcgtacaccgtcaccgagattggcgacgatggcgag
cgcgagttcaccatcgaccactaccgcgcgctcaactccaagcacgagatggacaaggtc
gtccaggagatcgcttccgccgatgtcgtcacctgcgctgtcggccccaacatcctcaag
ttcgtcgccgagcccgtcgccaaggccattgacgcccgcacactcgactaccccatcgcc
gtcattgcttgcgagaacgccatcaacgccacaaccacatggaggggcttcatcgagggc
aagctgagcgaggactccaagagcaacctcgacaagaaggcccgtttcgccaactcggct
attgaccgtattgtgcccgttcaggataaggatgccggcctcaacgtcaagatcgagaag
ttctacgagtggtgcgttgagcagaagccattcgagaacggtggcaagaagcctgatgtc
aagggcatccactacgtcgatgacctcgagccctacattgagcgcaagctgttcaccgtc
aacacctcgcacgccaccgctgcctactatggccaccaggcgaagaagcagtacatccac
gaggtcctccaggacaagaagctccacgacattgtccgtgacgctgtcaaggagactgct
cacctcatcgtcagcaagcacggtgtctccgtccaggagcagaacgactatgtcgactcc
atcatcaagcgtatctctaaccctgtcctgaaggacaacgtcgagcgcgtcggacgtgcg
cccctccgcaagctttcccgcaaggagcgttttgtcggcccagctgctcagctcgctgag
cgcggcgagaaggttgatgctctcctaggtgccattgagcaggcatacctcttccagaac
gttgagggtgacgaggagtctgctgagttggccaagatcctcaaggagaactccgccgag
gaggttgtcaccaaggtcaacggtcttgacaagtcacacccgctcttcgagaagatcctc
ccgatcgtcaagaaggttcagggtggcagctga

DBGET integrated database retrieval system