KEGG   Parastagonospora nodorum: SNOG_13467Help
Entry
SNOG_13467        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
pno  Parastagonospora nodorum
Pathway
pno00564  Glycerophospholipid metabolism
pno00565  Ether lipid metabolism
pno00590  Arachidonic acid metabolism
pno00592  alpha-Linolenic acid metabolism
pno01100  Metabolic pathways
pno01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SNOG_13467
   00565 Ether lipid metabolism
    SNOG_13467
   00590 Arachidonic acid metabolism
    SNOG_13467
   00591 Linoleic acid metabolism
    SNOG_13467
   00592 alpha-Linolenic acid metabolism
    SNOG_13467
Enzymes [BR:pno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     SNOG_13467
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B SpoIIIAH
Motif
Other DBs
NCBI-GeneID: 5980596
NCBI-ProteinID: XP_001803679
UniProt: Q0U447
Position
Unknown
AA seq 807 aa AA seqDB search
MFAFFEGCSTIHTKRPTPRASNVASLSLRYGPPCLVACAAAGYLSTAPSPFPLSRPIRLD
ASSAWSSWAPRILSGSQKQTAPTSAGAAEEKINEQNKDKPGEQDAPPQSRTSKEDGEEQA
DNTDSESSSAWQTIKNSFPSPPDIKSASSISDTLIDMVIPAWVKMMPGFIRKLQDELSMA
PGSLAEEIWSDANNPEANPEIVWDASVRISDELCKEEKAFRQKRAHFTKAALARYLDIPE
DTIHPDDIPIIAMCGSGGGLRALVAGTSSYLSTKEQGLFDCVTYTAGVSGSCWLQTLYYS
DITGQSHARLIRHLKNRLGIHIAFPPDALELLVSAPTNKYLLSALVEKAKGIPEAEFGIV
DIYGALLAARLLIPKGELSVSEYDFKVSNQRRFTDDGSNPLPIYTAVRHEIPLAEQASMT
DRVAAEAKARREAWFQWFEFTPYEMWCEELSAGIPTWAIGRQFDKGRTVWRENGLALPEV
RVPLLMGIWGSAFCATLSHYYKEIRPVLTGLTGFSSLDSMISERDDDLVKVHPIDPASIP
NYALGLREFLPSSCPESIFEQKNFQFMDAGMSNNLPIYPLLRPGRDVDILVAFDASADVR
TDNWLKVAQGYARQRGIKGWPVGAGWPPDDETMEELQDDLDKAQAKSEQQAESKISEAQE
QDEAEKKKSTKKKDLGFCNVWVGTTEERIAEHEPPVHSKQAEEDWELMHPSSGITVVYFP
FLANPKVPGVDPKTSDFMSTWNFVYTPEQIDGVVNLARENFAEGAERTKRTVRAVYERKK
KLREEREKEERERRWRWKLKQGRSWAE
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgttcgctttctttgagggatgcagcacgatacacaccaaaaggcctacccctcgcgca
tccaatgtcgcctctctgagcctccgctatggcccgccctgtctggtagcatgcgctgca
gctggctacctttcgaccgcgccctcgccgttccctctgtcccgtccaatccgcctcgat
gcatcctcggcatggtcctcttgggccccaaggatactctctggcagtcagaaacagact
gcaccaacatctgcaggagccgccgaagaaaagatcaacgaacaaaacaaggacaagccg
ggagagcaggatgcacccccacagtcacgcacctccaaggaggacggcgaagagcaggcc
gacaacaccgactctgagtccagttcggcatggcagacaatcaagaacagcttccccagc
ccgccagacatcaagtcggcgtcgtccatcagcgacaccttgatcgacatggtcattccg
gcctgggtgaagatgatgcccggtttcatccggaaactgcaagacgagctgtccatggca
ccaggctcgctggccgaagagatctggtccgacgccaacaaccccgaggccaacccggag
attgtctgggacgcctccgtgcgcatttccgatgagctgtgcaaggaagagaaggcattt
cgacagaagagggcccacttcacaaaggccgctctcgcacgctacctcgacatacccgaa
gacacgatacaccccgacgatatccccatcatagccatgtgcgggtctggtggagggctg
cgagcgcttgttgcaggcacatcgtcatacctctccaccaaggagcaaggcctcttcgac
tgcgtcacatacaccgccggtgtcagcggtagctgctggctgcagacactctactactca
gacattaccgggcagagtcacgcacgtctgatccgacatctgaagaaccgactcggcatc
cacattgccttcccgccagatgccttggagctcctcgtcagcgcccccaccaacaagtat
cttttaagtgccttggttgagaaggcaaaaggaattcccgaagccgagttcggcatcgtc
gacatctacggcgcacttcttgcagcgcgactcctcattccgaagggtgaactgtccgtg
agcgagtatgacttcaaggtctcgaaccaaaggcgcttcaccgacgacggctccaatcct
ctacccatctacaccgcagtgcgacacgagatcccactagccgaacaagctagcatgacc
gacagggtagccgctgaggcgaaagccaggagagaagcgtggttccagtggttcgaattc
accccatacgagatgtggtgcgaagagctctcagccggcattccaacgtgggcaatcgga
cgccagtttgacaagggacgaacggtctggcgagaaaatggtcttgctctcccagaagtg
cgcgtgccgctactcatgggcatctggggatctgccttctgcgcaacgctatcgcactac
tacaaggagattcggcctgtgctgactggtcttaccgggttcagcagtctcgattccatg
atttctgagcgcgacgacgacctggtcaaagtacatcccatcgaccccgcgtccattccc
aattacgctctcggtctgcgcgagttcctaccatcatcctgcccggagagcatattcgag
cagaagaactttcagtttatggacgccggcatgagcaacaacctgccaatctacccactc
ctccggcccggccgcgatgtcgacatcctcgtcgccttcgatgccagcgccgatgtccgc
acagacaattggctcaaagtcgcccaaggctatgcccgccaacgcggcatcaaaggctgg
cccgtcggcgccggctggcctcctgacgacgaaactatggaagagctccaagacgacctc
gacaaagcccaagccaagtccgagcagcaagcggaatccaagatctcagaagcgcaagaa
caggacgaagccgaaaagaagaaatcgacaaagaaaaaagacctcggcttctgtaacgtc
tgggtcggcacgactgaagaacgcatcgcagagcacgaacctccagttcactccaaacaa
gccgaagaagactgggaactcatgcatccctcatctggcatcacggtcgtatatttccct
ttcctcgcgaacccgaaagtccctggcgtagatcccaagacgagcgatttcatgagtacg
tggaatttcgtgtacacgcctgaacaaatcgatggtgtggtaaacctcgcgagagaaaat
ttcgccgagggtgcagaacgcacgaagaggacagttagggccgtgtatgaaagaaagaaa
aagctgagggaggagagggagaaggaagagagggagagacggtggaggtggaagttgaag
cagggaaggagttgggcagagtga

DBGET integrated database retrieval system