KEGG   Parastagonospora nodorum: SNOG_13707Help
Entry
SNOG_13707        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K01426  amidase [EC:3.5.1.4]
Organism
pno  Parastagonospora nodorum
Pathway
pno00330  Arginine and proline metabolism
pno00360  Phenylalanine metabolism
pno00380  Tryptophan metabolism
pno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SNOG_13707
   00360 Phenylalanine metabolism
    SNOG_13707
   00380 Tryptophan metabolism
    SNOG_13707
Enzymes [BR:pno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     SNOG_13707
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase Sigma54_CBD
Motif
Other DBs
NCBI-GeneID: 5980836
NCBI-ProteinID: XP_001803914
UniProt: Q0U3F7
Position
Unknown
AA seq 637 aa AA seqDB search
MRKASKFFRKALSQNVESPPPKGYIEKVQAERKMSFTSSTEGGMGMLPEFDPLIVSAFDL
SELMNAQAISSVEIVELYLHQIDEHNRRGRQLRALISVAPRHELLKIAKKLDDERLRGKV
RGPLHGIPIVVKDNIMTEEQLGMDTTVGSYAFVGCKPKKNATIVDRLIKRGVIIIGKANL
TEFCGLKNPSMPPGWSAVGGQCQSPYVSRHIAKRKLHWELSAPGGSSTGSAVAVASGFST
LAIGTDTIGSLITPANRAALYALKPTVGQVPMDGIFNLSKTFDAVGGMAKSAKDLVALMD
AMMVPTSRESDEVAPHRSFKIKSNFGKLRIGFVEPTIWKTWRKSGRINADAERFMLQKYD
MVVQSMIEMGVDIVYPVELPSQSSLTIDGKNCFEPVVYSEFKDCLTEFIRDFKTTKMHSL
AEIINFNLEHPELCLPPSCPDQNDLMAALQAPTKREEINAARQHLQIAGGPDGLDYLFTS
SQLDIVIAPGDAPLSSIAAAAGYPTAACPLSALKLNGQPFGLTLASRPHTEHTLLHFLTA
YENIFPPRALPLPLSSVPLQDAHPEMLPDQPIIDLILHEWDTRRFSCSADALADWLNARW
KKSGYELSPETVCEVLRSNGRIAFRGLGDDSEHAFTR
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaggcttccaagtttttcaggaaggcactttctcaaaacgtcgagtcgcctcca
ccaaaaggctacatcgagaaagtccaggctgagcgtaagatgtccttcacgtcgtcgact
gaaggaggcatgggcatgctaccagaattcgacccactcatcgtctccgcattcgatctg
tcagagttgatgaatgcacaagcaatatcaagtgttgagattgttgagctgtatttgcat
caaatcgatgaacataatcggagaggtcgccagttgcgggcgctgatctccgtggcacca
agacatgaattgctgaagattgcgaaaaagttggatgatgagcggttaaggggaaaggtt
agaggaccgctgcatggcataccgatagtggtgaaagacaacattatgacagaagagcag
ctgggcatggatacgacagtaggctcatacgcttttgttggatgcaaaccaaagaagaat
gcaaccattgtggacaggttgatcaagcgaggagtgatcattattggcaaagcaaacctc
acagaattctgcggtctcaagaatccttctatgccacctggatggtcagctgtaggcggc
cagtgccaatcaccatatgtttcacgacacattgcaaagagaaaactgcattgggagctt
tctgcaccgggaggctcgtctactgggtccgctgttgccgtagcttcaggcttcagcacg
cttgcgattggcacagatacgatcggatcactcattacgcctgcgaatcgcgctgctctc
tacgcactgaagcctacagtcggtcaagtaccaatggacggcattttcaacctcagcaag
acctttgatgcagtgggcggcatggcgaaatccgcaaaagaccttgtagcgctaatggac
gccatgatggttcccaccagcagagagtctgacgaggtggcaccgcacagatcattcaag
ataaaatcgaatttcggcaaactcaggatcggttttgttgagcccaccatctggaagaca
tggcgcaaaagtggtcgaatcaacgctgatgcagagcggtttatgctgcaaaagtacgat
atggtcgtgcaaagcatgatcgagatgggggttgatatcgtataccctgtcgagttgccg
agccagtctagccttaccattgatgggaagaattgtttcgagcctgtcgtttattctgag
ttcaaggattgcttgacagagttcatccgagacttcaaaacaaccaagatgcactcccta
gctgaaatcatcaacttcaacctcgaacaccccgagctttgcttacctccatcatgcccc
gaccaaaatgacctcatggctgccctccaagcccctaccaaacgcgaagaaatcaacgcc
gcccgccaacacctacaaatcgccggcggccctgacggcctcgactatctcttcaccagc
tcccaactcgacatcgtaatcgccccaggcgatgcgcccctctcctccatcgccgccgcc
gccggctacccaaccgcggcgtgtcccctctccgcgctcaaactcaacggccaacccttc
ggcctcaccctcgcctcgcgcccacacaccgaacacacactcctgcacttcctcaccgca
tacgaaaatatcttcccgccgcgcgcattaccgctgccgctcagttccgtaccgctgcaa
gacgcgcacccggaaatgctgcctgatcagcccatcatcgatcttatcttgcatgagtgg
gacacaagaagatttagctgctcggcggatgcgttggcggattggctgaatgcgaggtgg
aagaaaagcgggtatgaattgagtccggagacggtgtgtgaggtgttgaggagtaatggg
cgcattgcgtttagggggctgggggatgatagtgaacatgcgtttacgcggtga

DBGET integrated database retrieval system