KEGG   Parastagonospora nodorum: SNOG_14609Help
Entry
SNOG_14609        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pno  Parastagonospora nodorum
Pathway
pno00020  Citrate cycle (TCA cycle)
pno00310  Lysine degradation
pno01100  Metabolic pathways
pno01110  Biosynthesis of secondary metabolites
pno01130  Biosynthesis of antibiotics
pno01200  Carbon metabolism
Module
pno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pno_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SNOG_14609
  Amino acid metabolism
   00310 Lysine degradation
    SNOG_14609
Enzymes [BR:pno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SNOG_14609
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh DUF3614
Motif
Other DBs
NCBI-GeneID: 5981715
NCBI-ProteinID: XP_001804790
UniProt: Q0U188
Position
Unknown
AA seq 233 aa AA seqDB search
MSLQVKMNRMRLRIAERLKQSQNTAASLTTFNEVDMSSIMEFRKLYKDEILKNKGVKLGF
MSAFSRACILAMRDVPAVNASIEGPNGGDTIVYRDYVDISVAVATEKGLVTPVVRNAESL
DMVGIEGAIAELGKKARDNKLTIEDMAGGTFTISNGGVFGSLMGTPIINLPQTAVLGLHA
IKDKPVAINGKVEIRPMMYLALTYDHRLLDGREAVTFLVKIKEYIEDPRKMLL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtccttacaggtcaagatgaaccgcatgcgtcttcgcatcgctgagcgtctaaagcag
tcccagaacactgctgcctcgcttaccaccttcaacgaggtcgacatgtcatctatcatg
gaattccgcaagctctacaaggatgagatcctgaagaacaagggtgtcaagctcggcttc
atgtccgccttctcgcgcgcctgcatccttgccatgcgtgatgtgcctgccgtgaacgcc
tcgattgaaggccctaatggaggtgacaccattgtgtaccgcgactacgtcgacatttcc
gttgccgttgcgaccgagaagggtcttgtcacgcctgttgtccggaatgccgagagcctg
gacatggttggcatcgagggcgctatcgccgagctcggcaagaaggcgcgcgacaacaag
ctcaccattgaggacatggctggtggtacattcaccatctcgaatggtggcgttttcggc
agcttgatgggcaccccgatcatcaacctgccacagactgctgttttgggtctgcatgca
atcaaggacaagccagtcgccatcaacggcaaggtcgaaatcaggccgatgatgtacttg
gcccttacctacgaccacaggctgcttgacggtcgggaggccgtgaccttcttggtcaag
atcaaggagtatattgaggaccccaggaagatgcttttgtag

DBGET integrated database retrieval system