KEGG   Parastagonospora nodorum: SNOG_14684Help
Entry
SNOG_14684        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pno  Parastagonospora nodorum
Pathway
pno00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SNOG_14684
Enzymes [BR:pno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SNOG_14684
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SNOG_14684
    1.1.1.-  
     SNOG_14684
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-GeneID: 5981793
NCBI-ProteinID: XP_001804867
UniProt: Q0U0G9
Position
Unknown
AA seq 160 aa AA seqDB search
MGTGPIGYALVLIPKAFGATRVIGSEPSATRRRQVDDFRVLSRRHRSHGRVDHVIQQVTY
GQGVDVVFDCAGAPSAVESGVNALCFQGTYVIMTAFEKPVVLPAAAIFGTELVVEGPVTF
ADGGMKEAIKTMIEGRLQGYAKMITGRISLHDLVDKGFNA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgggcacggggccaatcggatacgcgctcgtcctcattcccaaagcgttcggagcaaca
cgagtcattggttccgagccctccgcaacaaggagacgccaggtggacgacttccgcgta
ttaagtaggcgccatcggtcccatggcagagtagaccatgtaattcaacaagtcacctac
gggcagggagtcgacgtcgtcttcgactgtgcgggtgcgccatcagccgtggagagcggt
gtgaacgcgctgtgcttccaaggcacttatgtgattatgacagcatttgagaagcctgtg
gtgctgccagcagcagccattttcggtacagagctcgtagtggaggggccggttactttt
gctgacggcggcatgaaagaggccatcaagacgatgatcgaaggccgcttgcagggatac
gcaaagatgatcacgggacgcatctcgctgcacgacctggttgacaaaggcttcaatgcg
tga

DBGET integrated database retrieval system