KEGG   Parastagonospora nodorum: SNOG_15269Help
Entry
SNOG_15269        CDS       T01161                                 

Gene name
SNOG_15268
Definition
(RefSeq) hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pno  Parastagonospora nodorum
Pathway
pno00260  Glycine, serine and threonine metabolism
pno01100  Metabolic pathways
pno01110  Biosynthesis of secondary metabolites
pno01130  Biosynthesis of antibiotics
pno01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SNOG_15269 (SNOG_15268)
Enzymes [BR:pno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SNOG_15269 (SNOG_15268)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 5982353
NCBI-ProteinID: XP_001805425
UniProt: Q0TZE4
Position
Unknown
AA seq 347 aa AA seqDB search
MLRAIQQCTLLDDVTMEDPTTLSLERFIADLAGKEDALLVLSGTMGNQVALRTHLTAPPQ
AVLCDRRGHIINYEAGGVASLSQAMLQPIDAKNGTYITLEEVQKYAVISDDVHACPTRVI
SLENTLNGAIMPLSEVRRISAWARESGIIMHLDGARLWEAVAAGAGTLKEFCAEFDSISL
CFSKGLGAPIGSIIVGTKAFIKRSRWIRKSIGGGLRQAGVVAAPARVAVEETFLGGKLTQ
SHENAKKIQKIWTDLGGKLQYPVDTNMVWLDLEAHGIDIDHFIELSEQYGVKVRGGRFVV
HYQVGEEAIERLRKIFTDILHGTESPGKSQHAEHDPELLKLKGKGIE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgagctatccagcaatgcacactgctagacgatgtgaccatggaggaccccacc
actttgtccctggagcgcttcattgccgacctagcaggcaaagaagacgccctgcttgta
ctgtctggtacgatgggcaaccaggttgcgctgcgcacgcatctgactgcccctccgcaa
gctgttctatgtgaccgacgtggacacatcataaattacgaggctggcggcgtggcgagt
ctcagtcaggccatgctgcagcccatcgacgccaagaacggtacatacatcacactggaa
gaggtgcagaagtacgccgttatctctgacgacgttcatgcctgccctacacgcgttatt
tcgttagagaacacgctcaacggtgccatcatgcctctctccgaggtgcgtcgcatatct
gcctgggcgcgggagagcggcatcatcatgcacttggacggagctcgtctatgggaggcg
gttgccgctggtgccggcaccctcaaagagttctgcgccgaattcgacagcataagtctg
tgtttcagcaaagggctcggagcgccaatcggcagtattattgtaggcacaaaggctttc
atcaaacgcagccgctggattcgaaagtccatcggcggcggcttgcgacaagcaggtgtc
gttgcagcacctgcacgtgtcgcggtcgaggagacctttttgggtggtaagctcacgcag
tcacacgaaaatgcgaagaagattcagaagatctggaccgacttgggaggcaagctacaa
taccctgttgatacgaacatggtatggctcgatctcgaggcccacggcattgacattgat
cacttcattgagctttcggaacagtacggtgtcaaggtacgtggtggcagatttgtcgta
cactaccaagttggcgaagaagcaattgagaggctgcgcaaaatatttacagacatcctt
catggcacagaatcaccaggcaagtcgcaacatgctgagcatgaccctgaactgttgaag
ctcaagggaaaggggattgagtag

DBGET integrated database retrieval system