KEGG   Parastagonospora nodorum: SNOG_15384Help
Entry
SNOG_15384        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
pno  Parastagonospora nodorum
Pathway
pno00020  Citrate cycle (TCA cycle)
pno00640  Propanoate metabolism
pno01100  Metabolic pathways
pno01110  Biosynthesis of secondary metabolites
pno01130  Biosynthesis of antibiotics
pno01200  Carbon metabolism
Module
pno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pno_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SNOG_15384
   00640 Propanoate metabolism
    SNOG_15384
Enzymes [BR:pno01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     SNOG_15384
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SNOG_15384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 5982463
NCBI-ProteinID: XP_001805534
UniProt: Q0TYV9
Position
Unknown
AA seq 328 aa AA seqDB search
MQALRYPLRSALTKSATRQYATGSSQYAETIKNLRINGDTKVLFQGFTGKQGTFHAQQAI
EYGTKVVGGTNPKKAGSEHLGKPVFASVADAIKETGATASAIFVPPPVAAKSIEEAIAAE
VPLIVTITEGIPQHDMVRITDMLKSQNKSRMVGPNCPGIIAPGQCKIGIMPGFIHKRGRV
GIVSRSGTLTYEAVNQTTQAGLGQSLVVGIGGDPFSGTNFIDCLKVFLQDEETDGIIMIG
EIGGSAEEDAADFLKEYNTANKPVVSFIAGISAPPGRRMGHAGAIVSGGKGDANSKINAL
EAAGVVVERSPARLGSTLYDQFVKRDLI
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctctccgatacccactgcgctcggcgctcaccaaatccgctaccaggcagtat
gcgacaggctcttcgcagtatgccgagaccattaagaacctccgtatcaatggcgacaca
aaagtgctgttccagggcttcactggaaagcagggcaccttccacgcacaacaagcgatt
gagtacggcacaaaagttgtcggaggcaccaaccccaagaaggccggctcagaacatctc
ggcaagcccgtctttgccagcgtagcggatgctatcaaagagactggtgcgaccgcttcc
gccatttttgtccccccgccagttgccgccaagagcattgaggaagccatcgctgcagag
gtacctttgattgtgaccatcaccgagggcatcccacaacatgacatggtccgcatcacc
gacatgctcaagtcgcagaacaagtcccgcatggtcggccccaactgccctggcataatc
gctcctggacaatgtaagattggcatcatgcctggcttcatccacaaacgcggccgtgtc
ggaatcgtatctcgctccggaaccctcacgtacgaagccgtgaaccaaaccacccaagcc
ggccttggccagtcgctcgttgtcggcattggtggagaccccttctcaggaaccaacttc
atcgactgcctcaaggtcttcttgcaggacgaggagacggacggtatcattatgattgga
gagattggtggctcagccgaggaggacgccgcagatttcctcaaggagtacaacactgcc
aacaagcccgttgtcagcttcattgctggcatctctgcgcctccaggcaggcgtatgggc
cacgctggcgccattgtcagtggaggaaagggtgatgccaactccaagatcaacgccctc
gaggctgctggtgttgtcgttgagcgctctcctgccaggcttggatcgactctgtatgat
cagttcgtcaagcgtgatctgatatag

DBGET integrated database retrieval system