KEGG   Paenibacillus naphthalenovorans: IJ22_11010Help
Entry
IJ22_11010        CDS       T04167                                 

Definition
(GenBank) 1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
pnp  Paenibacillus naphthalenovorans
Pathway
pnp00250  Alanine, aspartate and glutamate metabolism
pnp00330  Arginine and proline metabolism
pnp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pnp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    IJ22_11010
   00330 Arginine and proline metabolism
    IJ22_11010
Enzymes [BR:pnp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     IJ22_11010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALS21479
UniProt: A0A0U2VPN5
Position
1117112..1118659
Genome map
AA seq 515 aa AA seqDB search
MVEPFCNEPFTDFSQSGNREAFAAALKKVQAQLGQEYGLLIGGEKLMTARKAVSVNPADP
TQVIGTVSQADTALADRAIRAAARAFTFWKSVPPAGRARLLYKIAAILRRRKAEFSAWMV
VEAGKSWAEADADTAEAIDFLEFYGRETERLAQRQPLTRIPGEDNELTYIPLGVGVIIPP
WNFPLAIMAGLTSAAVAAGNTVVLKPASATPVVAAKFMELLQLAGLPDGVVNFLPGSGQE
VGDYLVEHPLTRFISFTGSREVGLRINELAAKTAPGQRWIKRVVAEMGGKDAIIVDSDSD
LELAAEAITASAFGFAGQKCSACSRAIVHESVYDDVLRRVAERVSRLRVGDPSDPEIDVG
PVIDAKAHLKILEYLEIGSTEGRVVCGGGAGDAKGYYIEPTVIADVDVKARIAQEEIFGP
VVAFIKAASFDQALELANDSEYGLTGAVISRNRAHLEKARTEFHVGNLYFNRKCTGALVG
VHPFGGFNMSGTDSKAGGRDYLLQFTQAKVVSERF
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggtagagcctttttgcaacgaaccgttcacggattttagccaatccgggaacagagag
gcattcgcagcagcgctgaagaaggtacaagcgcagctcggccaagaatacgggctgctg
atcggcggtgagaagctgatgacggcccggaaggccgtttccgtcaatcctgccgatccg
acgcaggtgatcggaacggtgagccaggcggacaccgcgttggcagatcgggcgatccgt
gcggcagcgcgcgcgtttacgttctggaaatcggtgcctccggcggggcgggcgcgtctt
ttatacaaaatcgccgcgatcctgcgccgccgtaaagccgagttttccgcctggatggtg
gtggaagcggggaaaagctgggcggaggcggatgccgataccgcagaagcgatcgatttt
ctggagttttacggcagggaaacggaacgtttggcgcagcggcagccgcttacgcgaata
ccgggcgaggacaacgagcttacctatattccgctgggtgtcggcgtaatcatacctcca
tggaattttccgttagccattatggcgggattgacatcggcagccgtggctgccggcaat
acggtggtgctgaaaccggccagcgcgacaccggttgtggctgccaagtttatggagctg
cttcaattggccggcctgccggatggagtggtcaacttcctgccgggttccggacaggag
gtgggcgattacttggtggagcatccgctgacccgctttatcagctttacgggatcccgc
gaggtagggctgcggatcaacgagctggcggccaaaaccgcacccggccagcgctggatc
aagcgcgtagtcgccgaaatgggcggcaaggatgcgattatcgtcgacagcgacagtgac
ctggagctggcggcggaggccattacagcgtccgccttcgggtttgccgggcaaaagtgc
tctgcctgctcccgcgccatcgtacatgagagcgtatatgacgatgtgcttcgcagggtg
gcagaacgcgtaagccgtctgcgtgtgggtgatccgtccgatcctgagattgacgtgggg
ccggtgatcgacgccaaggctcaccttaaaattctcgaatatctggaaattggaagcacg
gaaggcagggtagtttgcggaggcggagcgggagatgccaagggatattatatcgagccg
acagtaattgccgatgtcgacgtcaaggcgcggatcgcgcaagaggaaattttcggaccg
gtggttgcgtttatcaaagcggcctcgtttgaccaggcgctcgaactggccaatgattcg
gagtacgggctgaccggagccgttatttcaagaaatagggctcatttggagaaggcccgt
actgagtttcatgtcggcaatctgtatttcaaccgcaaatgcacgggagcgctggtggga
gttcatccgttcggcggcttcaacatgtcgggaacggattcgaaagcggggggacgcgat
tatctgcttcagtttacccaagccaaggtcgtctccgaacgcttctga

DBGET integrated database retrieval system