KEGG   Paenibacillus naphthalenovorans: IJ22_12450Help
Entry
IJ22_12450        CDS       T04167                                 

Definition
(GenBank) subunit alpha of succinyl-CoA synthetase
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
pnp  Paenibacillus naphthalenovorans
Pathway
pnp00020  Citrate cycle (TCA cycle)
pnp00640  Propanoate metabolism
pnp00660  C5-Branched dibasic acid metabolism
pnp01100  Metabolic pathways
pnp01110  Biosynthesis of secondary metabolites
pnp01120  Microbial metabolism in diverse environments
pnp01130  Biosynthesis of antibiotics
pnp01200  Carbon metabolism
Module
pnp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pnp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pnp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IJ22_12450
   00640 Propanoate metabolism
    IJ22_12450
   00660 C5-Branched dibasic acid metabolism
    IJ22_12450
Enzymes [BR:pnp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     IJ22_12450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: ALS21621
UniProt: A0A0U2W282
Position
1255282..1256214
Genome map
AA seq 310 aa AA seqDB search
MSILVDKNTKVITQGITGSVGMFHTKGGLDYGTQMVGGVTPGKGGTNVDIALENGTTVSI
PVFNTVAEAKAATGATASVIYVPPAFAADAIMEAVDAELDLVICITEGIPVLDMVKVKRY
MEGKKSRLIGPNCPGVITPGECKIGIMPGYIHTPGHVGVVSRSGTLTYEAVHQLSTRGIG
QSSAVGIGGDPVKGSEFIDILKLFNEDPDTYAVIMIGEIGGSAEEEAAEWIAANMKKPVV
GFIGGQTAPPGKRMGHAGAIISGGKGTAAEKVATLERCGIKVAPTPSEMGSTLVSVLEEK
GLLEKCITKK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagtattttggtcgataaaaatacaaaagtcattacacaagggattaccggttccgta
gggatgttccatacaaagggcggacttgattacggcacacaaatggtaggcggcgtcact
ccaggcaaaggcggcacaaacgtcgacatcgcgctggaaaacggtacaaccgtctcgatt
cctgtattcaacacggtagctgaggcaaaagcggcaacaggtgcaaccgcgtccgttatt
tacgttccgccggctttcgcggcagatgcgatcatggaagccgttgatgctgagctggac
ctggtcatctgcattacagaaggcattcctgttctcgacatggttaaggtaaagcgttat
atggaaggcaagaagtcccgtttgatcggaccaaactgccctggcgtcattactccgggc
gaatgcaaaatcggtattatgcccggctatatccacactcctggtcatgtcggcgtcgtt
tcccgaagcggaacactgacttacgaagccgttcatcaactgtctacacgcggcatcggt
caatcgtcggccgttggtatcggcggagaccccgtgaagggctcggagtttatcgatatc
ctcaagctgttcaatgaagatccggacacctatgcggtgatcatgatcggtgaaatcggc
ggctccgcagaagaagaagcggccgagtggattgcagccaacatgaaaaaaccggtggtc
ggcttcatcggcggacaaacggcgcctcctggaaaacgtatgggccatgccggcgcgatc
atctccggcggtaaaggcacggcagcagagaaagtcgcaacgctggaacgctgcggcatt
aaagtagctccgaccccttccgagatgggttccaccctggtcagtgttttggaagaaaaa
ggcctgcttgagaaatgcatcactaaaaagtaa

DBGET integrated database retrieval system