KEGG   Paenibacillus naphthalenovorans: IJ22_13870Help
Entry
IJ22_13870        CDS       T04167                                 

Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
pnp  Paenibacillus naphthalenovorans
Brite
KEGG Orthology (KO) [BR:pnp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    IJ22_13870
Enzymes [BR:pnp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     IJ22_13870
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     IJ22_13870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA Iso_dh
Motif
Other DBs
NCBI-ProteinID: ALS21763
UniProt: A0A0U2VE25
Position
complement(1392905..1393930)
Genome map
AA seq 341 aa AA seqDB search
MLQEEALMNNQKPVIMITIGDPAGIGPEISLKALLDKKTYEICNPILIGDKNLLAWYIRL
LQAPLTLHPITEPGEALFQYGLIDVIHMPNVKIDRLQIGEPAADCGLAMLEYTNKALQLA
LEGKVQAVIGGPHTKKSVELAGVEFDGYPSYVAKVTGTKPEEAFLMLVSDRLRIVNVTLH
VSLRRALQMINKQLVLKAIRAADKAVRSMGIQAPQMAVAGLNPHAGEQGMFGTEEIEDIE
PAILQAQREGIHAFGPYGSDTLFLEHCELKYDAYIAMYHDQAHLPIKLLAFDKITAFTIG
TPVFFCTVGHGSAPDIAGKGVASPNSLLESIRLVSHVPVTG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaggaggaagcccttatgaataatcagaaacccgtcattatgataaccatcggc
gaccccgccgggatcggtccggaaatttcccttaaggctctcttagacaaaaaaacgtat
gaaatatgcaatccgattctgatcggagataagaacttactggcgtggtacatccgtctt
ttacaggctccgttaaccctgcatccgattacggaaccgggtgaagctctgttccaatac
gggcttatcgatgtgatacatatgcctaacgtcaagatagaccggctgcaaattggagaa
cctgccgccgactgtggactagccatgctggagtatacaaacaaggcattacagctggca
ttggaaggcaaggtacaggcagtgatcggaggaccccataccaagaaatcggtagagctc
gccggggtcgaatttgacgggtatccaagctacgttgccaaggtaaccggcacgaagcct
gaggaagcattcttgatgttagtctccgaccgactgcgcattgtgaacgtcactctgcat
gtgtcactgcgaagggctttgcaaatgatcaacaagcagctggtgctcaaagcgataagg
gcagccgacaaagcggtgcgcagcatggggatccaagcgcctcaaatggcagtagccggt
ttaaatccgcatgccggtgaacaaggaatgttcggaacagaagaaatcgaggatattgaa
ccggctatcctgcaagcacaacgggaaggcattcatgcctttggaccatatggaagcgac
accctgtttcttgagcattgtgagctcaaatacgatgcttatatcgctatgtaccacgat
caagcccatctgccgatcaagctattggcattcgataaaattaccgcgtttactatcggc
acccctgttttcttttgcaccgtcggtcatggcagcgcaccggatattgccggcaaaggt
gttgcttccccgaacagtttactggaatccatccgtctggttagtcatgttccggtaacg
ggttaa

DBGET integrated database retrieval system