KEGG   Paenibacillus naphthalenovorans: IJ22_14520Help
Entry
IJ22_14520        CDS       T04167                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pnp  Paenibacillus naphthalenovorans
Pathway
pnp00071  Fatty acid degradation
pnp00280  Valine, leucine and isoleucine degradation
pnp00310  Lysine degradation
pnp00362  Benzoate degradation
pnp00380  Tryptophan metabolism
pnp00620  Pyruvate metabolism
pnp00630  Glyoxylate and dicarboxylate metabolism
pnp00640  Propanoate metabolism
pnp00650  Butanoate metabolism
pnp00900  Terpenoid backbone biosynthesis
pnp01100  Metabolic pathways
pnp01110  Biosynthesis of secondary metabolites
pnp01120  Microbial metabolism in diverse environments
pnp01130  Biosynthesis of antibiotics
pnp01200  Carbon metabolism
pnp01212  Fatty acid metabolism
pnp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pnp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    IJ22_14520
   00630 Glyoxylate and dicarboxylate metabolism
    IJ22_14520
   00640 Propanoate metabolism
    IJ22_14520
   00650 Butanoate metabolism
    IJ22_14520
  09103 Lipid metabolism
   00071 Fatty acid degradation
    IJ22_14520
   00072 Synthesis and degradation of ketone bodies
    IJ22_14520
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IJ22_14520
   00310 Lysine degradation
    IJ22_14520
   00380 Tryptophan metabolism
    IJ22_14520
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IJ22_14520
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IJ22_14520
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    IJ22_14520
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pnp04147]
    IJ22_14520
Enzymes [BR:pnp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IJ22_14520
Exosome [BR:pnp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IJ22_14520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Dodecin Spo0M
Motif
Other DBs
NCBI-ProteinID: ALS21828
UniProt: A0A0U2VZY8
Position
1463426..1464607
Genome map
AA seq 393 aa AA seqDB search
MAKREVYLIEGARTAFGEFGGSFKDVTAIDLAAACARKAMEKSNVSPEEIDQVVIGNVIQ
SSPDAVYTGRHVGLKSGVPKHVPGLTVNRLCGSGLQAIISAAQSILLGEADLALAGGAEN
MSQVPHVIRGARWGIPLGKAPMEDYLWETLYDPYGDCTMATTAENLAVKYGITREQADAY
SVRSQQRALKAIETGIFSEEIVPYTVKGRKGDILVDRDEHPRSTTMEALSRLPSRFTIDG
VVTAGNASGMNDGAAVTVIASEESVIRRGLKPLARLVAWGIVGVEPAMMGIGPADAIRQA
LQRAGMTLQQLDLIEINEAFAAQYLACRQELDFDPEKGNVNGGAVALGHPLGASGARITL
SLLYELRRRNQRFGVSSLCIGGGQGIAAIWERV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaacgcgaggtttatctcatcgaaggcgcgcgaaccgccttcggtgaattcggg
ggttccttcaaggacgtcacggctattgatctggccgcggcatgcgcccgtaaagcgatg
gaaaaatctaatgtatcgccggaggaaatcgatcaggtcgtgatcggcaatgtcattcaa
tccagcccggatgccgtttatacgggaagacatgtcggcttaaagtcgggtgtccccaag
catgttccggggcttacggtgaaccgcctctgcggttccggcctgcaggcgatcatcagt
gcggcccaatcgattctgttgggagaggccgatttggcgcttgctggcggcgcggaaaat
atgagccaggtgccgcatgtgattcggggcgccagatggggtattccgcttggcaaagct
cccatggaggattatttgtgggagacgctttacgatccttatggagattgcacgatggcg
accactgcagaaaacctggccgttaaatacgggattaccagagagcaagcggacgcttac
tccgtccggagtcagcagcgagcgctgaaggctatagaaacaggcattttttcggaagaa
atcgttccttatacggtaaaagggagaaaaggcgatatccttgttgaccgggatgagcat
cctcgatcgacaacgatggaagccctctccaggcttccctcccgatttacgatagacggc
gtcgtcacggccggcaacgcaagcggcatgaatgatggcgcggccgtaacggtcatcgct
tcggaggagtcggtgatccggcgcggcttaaaacctctcgcgcgattggtggcgtggggc
attgtaggcgtggagccggccatgatgggcatcggacccgccgacgccattcgccaggca
ttgcaaagagcgggaatgacccttcagcagttggatttgattgaaattaacgaagcgttc
gcagctcaatatctcgcctgccggcaggagctcgattttgatcccgagaaaggcaacgtg
aatggcggcgccgttgcgttaggccatccgctcggagccagcggtgcccgaatcacgctg
tccttactgtacgaactgcgccgcagaaaccaaagattcggtgtttcctccttatgcatc
ggcggcggccaagggatcgcagcgatctgggagcgagtctga

DBGET integrated database retrieval system