KEGG   Paenibacillus naphthalenovorans: IJ22_16880Help
Entry
IJ22_16880        CDS       T04167                                 

Definition
(GenBank) family IA HAD hydrolase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
pnp  Paenibacillus naphthalenovorans
Pathway
pnp00361  Chlorocyclohexane and chlorobenzene degradation
pnp00625  Chloroalkane and chloroalkene degradation
pnp01100  Metabolic pathways
pnp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pnp00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    IJ22_16880
   00361 Chlorocyclohexane and chlorobenzene degradation
    IJ22_16880
Enzymes [BR:pnp01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     IJ22_16880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: ALS22062
UniProt: A0A0U2W6J7
Position
complement(1705591..1706274)
Genome map
AA seq 227 aa AA seqDB search
MSYRLISFDVYSALANIEGSLIPELTKEIGSNKLDTTAFFRTWRTRQWDYLLLNNSLDTG
YLSYDTITLRALDYTAKRFGIQLADEARERLLLAWTRLRLWPEAAEVLSEIQNRGYAIAI
LSNGTEAMLQALQEEIGIHFDYIFSSDQAEAYKPSPKIYQLPFTRLGLDRRELLHVAGSV
FDVMGAKSAGLTCAWSNRLNDYTLDPRYSPDYEMADLTGLLQMISPK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtcctatcggttgatttctttcgatgtatactcggctttggctaatattgaagggagt
ctgattcccgagctcacaaaggaaattggttcaaataagcttgatacgacggcgtttttt
cggacgtggcgtacccggcagtgggattatttattgcttaacaattcgttggatacggga
tatttaagctatgataccatcaccctccgcgcattggactacacagccaagcgtttcggc
attcagctggccgatgaagcgagagaacgattgttactggcttggacgagactgcgcctt
tggccggaggcggcggaggtcctgtccgaaatccaaaatagaggctacgccatcgccatt
ttgtccaacggaacggaagcgatgctgcaagcgcttcaagaggagatcggcattcatttt
gattacattttttcttccgatcaggccgaagcatataaaccaagccccaaaatttatcag
cttccgtttacccgtctcggattggatagaagggaattattgcatgttgcgggctcggtg
tttgatgtgatgggagccaaatcagcggggcttacctgcgcctggtccaaccggctgaat
gattatacgcttgacccccgttacagcccggattatgaaatggctgatttaacggggctg
cttcaaatgataagccccaagtag

DBGET integrated database retrieval system