KEGG   Pandoraea norimbergensis: AT302_02130Help
Entry
AT302_02130       CDS       T04226                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pnr  Pandoraea norimbergensis
Pathway
pnr00071  Fatty acid degradation
pnr00072  Synthesis and degradation of ketone bodies
pnr00280  Valine, leucine and isoleucine degradation
pnr00310  Lysine degradation
pnr00362  Benzoate degradation
pnr00380  Tryptophan metabolism
pnr00620  Pyruvate metabolism
pnr00630  Glyoxylate and dicarboxylate metabolism
pnr00640  Propanoate metabolism
pnr00650  Butanoate metabolism
pnr00900  Terpenoid backbone biosynthesis
pnr01100  Metabolic pathways
pnr01110  Biosynthesis of secondary metabolites
pnr01120  Microbial metabolism in diverse environments
pnr01130  Biosynthesis of antibiotics
pnr01200  Carbon metabolism
pnr01212  Fatty acid metabolism
pnr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pnr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AT302_02130
   00630 Glyoxylate and dicarboxylate metabolism
    AT302_02130
   00640 Propanoate metabolism
    AT302_02130
   00650 Butanoate metabolism
    AT302_02130
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT302_02130
   00072 Synthesis and degradation of ketone bodies
    AT302_02130
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AT302_02130
   00310 Lysine degradation
    AT302_02130
   00380 Tryptophan metabolism
    AT302_02130
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AT302_02130
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AT302_02130
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AT302_02130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pnr04147]
    AT302_02130
Enzymes [BR:pnr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AT302_02130
Exosome [BR:pnr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT302_02130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALS58756
UniProt: A0A0U2XWN7
Position
complement(4845478..4846644)
Genome map
AA seq 388 aa AA seqDB search
MVAACLTGWAHSQFGKLDNVDAEVLLAQVAQAALDDAGLAPEQIDSIHVGTFNGGFLYQD
FPSSLVFNNIPGLRFKPATRYENACATGSAAVHGGLQSIEAGKATHVLVIGFEKMTELAT
PQVGEVLLKCSYAREEAGIPGGFAGVFGTIAQQYFDRYGDQSDALARIAAKNHRNGTDNP
YAHMRRDFGYDFCRNVSDKNPFVAGPLKRTDCSMVSDGAAALVISKADVARTMPKAVGFR
AAVQVNDYLPLSRRDALAFEGGQHAWRQALGVAGVSLKDLSLVETHDCFTIAELIEYEAM
GLAKPGQGANVVAEGLTEKDGLLPVNPSGGLKSKGHPVGATGVSMHVMAAMQLTGTAGGM
QIPNAKLAGVFNMGGAAVANYVSILEAR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggttgctgcatgccttaccggctgggcccactcccagttcggcaaactcgataacgtc
gacgccgaagttctgctggcccaagtcgcgcaagccgcgctcgatgatgcgggcctcgcg
cccgagcagatcgattcgattcatgtcggcactttcaatggcggtttcctgtatcaggac
ttcccgtcgtcgctcgtcttcaacaacattcccggcctgcgcttcaaacccgccacgcgt
tacgaaaacgcttgcgcgacgggttcggctgccgtgcacggcgggctgcaatcgatcgaa
gccggcaaggcgacgcacgtgctcgtgatcggcttcgagaagatgaccgagctcgccacg
ccgcaggtcggcgaagtgctgctcaagtgttcgtatgcgcgtgaagaagccggcattccg
ggcggtttcgccggtgtgttcggcaccattgcgcagcagtacttcgaccgctacggcgac
cagtccgacgcgctcgcgcgcatcgcggcgaagaaccatcgcaacggcacggacaatccg
tacgcgcacatgcgtcgcgacttcggctacgacttctgccgcaacgtctccgacaagaac
ccgtttgtggcgggtccgctcaagcgcaccgattgctcgatggtctccgacggcgctgcc
gcactggtgatctcgaaggccgacgttgcccgcaccatgccgaaggccgtgggcttccgg
gcggccgtgcaggtcaacgactacctgccgctctcgcgccgcgacgcgctcgcgttcgaa
ggcggccagcatgcatggcgtcaggcgctcggcgtggccggggtgtcgctcaaggacctg
tcgctggtcgagacgcacgactgcttcaccatcgccgagctgatcgagtacgaagccatg
gggctggccaagccgggtcagggcgccaacgtcgtggccgaagggctgacggaaaaagac
ggcctgctgccggtcaacccgtcgggcggcctgaagtccaagggacatccggtcggcgcc
acgggcgtctcgatgcacgtgatggcggcgatgcaactcaccggtacggcgggcggcatg
cagattcccaatgccaaactcgcgggcgtgttcaacatgggcggcgccgcggtggccaac
tacgtgagcattctcgaagcgcgctga

DBGET integrated database retrieval system