KEGG   Pandoraea norimbergensis: AT302_03395Help
Entry
AT302_03395       CDS       T04226                                 

Definition
(GenBank) 2,5-dioxovalerate dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
pnr  Pandoraea norimbergensis
Pathway
pnr00040  Pentose and glucuronate interconversions
pnr00053  Ascorbate and aldarate metabolism
pnr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pnr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AT302_03395
   00053 Ascorbate and aldarate metabolism
    AT302_03395
Enzymes [BR:pnr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     AT302_03395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALS58963
UniProt: A0A0U2WDZ2
Position
5130998..5132569
Genome map
AA seq 523 aa AA seqDB search
MQITGEMLIGRADVRGSAGSLDAFDPARGERIAPAFGAGTPQDVDRACELARAAFDPFRA
LPLAKRAEFLETVAQAILDLGDALIERAHAESGLPVARLQGERGRTVGQLRMFAQVVRDG
HFLDATIDPAQPARQPLPRSDLRLSKIGLGPVAVFGASNFPLAFSVAGGDTASAFAAGCP
VVVKAHSAHLGTSELVARAVRSAVQKLGLPEGVFSLLVGERAVGEALVAHPAIAAVGFTG
SRTGGLALQRIAQARAVPIPVYAEMSSINPVYVLPEALAARGEAIAKGFADSLTMGVGQF
CTNPGLVLGIAGDALERFCQSAGEALTAKAAGTMLTAGIHQAYDKGVARLADEGNVSLVA
RGQAGTGCQGQAALFRTTAAAFLATPALHDEVFGPASVVIACESVDEMIAITERLEGQLT
ATLQLDAGDVETARRLLPSLERRAGRILANGFPTGVEVCHAMVHGGPFPATSNAMFTSVG
ATAIDRFLRPVCYQDLPDALLPDALRQDNPLSLWRLVDGALTR
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcaccggtgagatgttgattggccgcgccgacgtgcgcggcagcgcgggctcg
ctggacgcgttcgatcctgcgcgcggcgagcgaatcgcccccgcgttcggcgcgggcacc
ccgcaggacgttgaccgtgcctgcgaactcgcgcgcgccgcgttcgatccgttccgtgca
ttgccgctggccaagcgcgctgaatttctcgagaccgtcgcgcaagcgattctcgatctg
ggcgacgcgctcatcgagcgcgcccatgccgaaagcggtctgcccgtagcgcgcttgcaa
ggcgagcgcggtcgcacggtcggtcaactgcggatgtttgcgcaggtggtgcgtgacggg
cattttctcgacgccacgatcgacccggcacaacctgcgcgccagccgttgccgcgtagc
gatttgcgcctgtcgaagatcggcctcggtccggtcgccgtgttcggcgcgagcaacttc
ccgctggcgttctcggtggccggtggtgatacggcctcggcatttgctgccggttgtccg
gtcgtcgtgaaggcgcactcggcgcatttaggcacctcggaactcgtggcccgcgccgtg
cgctccgcagtgcagaagctaggcctgccggaaggtgtcttctcgctgctcgtcggcgag
cgcgcggtgggcgaggcgctggtcgcgcacccggcgattgcggcggtcggcttcacgggc
tcgcgcacgggaggtcttgccttgcaacgcatcgcgcaagcgcgggcggtgccaattccc
gtgtatgcggaaatgagcagcatcaatccggtgtacgtgctgcccgaagcactcgcggcg
cgcggtgaggcgattgccaagggcttcgccgactcgctcacgatgggcgtcggtcagttc
tgcacgaacccggggctggtgctgggtatcgcgggcgatgcgctggagcggttctgccag
agcgccggtgaagccctcaccgccaaggcggcgggcacgatgctgacggcgggcattcat
caggcttacgacaagggcgtcgcacgtctggccgatgagggcaatgtgtcgctggtggcg
cgcggacaggcaggcacgggatgtcaggggcaagcggccctcttccgcacgacggcggcg
gcgtttctcgccacaccggcgctgcacgacgaggtgtttggcccggcgtcggtcgtcatt
gcctgtgagagtgtcgacgagatgatcgcgatcaccgagcgtctcgaaggccaactcacc
gccacgctgcaactcgacgcaggcgacgtggagacggcacgccgtctgctgccgagtctg
gagcgccgcgccggacgtattctcgcgaacggttttccgaccggcgtcgaagtgtgtcat
gcgatggtgcacggcggcccgttcccggccacgtcgaacgcgatgttcacgtccgtcggt
gccacggcgatcgatcgcttcctgcgcccggtctgctatcaggacctgcccgatgcgctg
ctgccggacgccctgcgtcaagacaatccgctcagtctgtggcgtctggtcgatggtgcg
ctaacacgatga

DBGET integrated database retrieval system