KEGG   Pandoraea norimbergensis: AT302_05410Help
Entry
AT302_05410       CDS       T04226                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
pnr  Pandoraea norimbergensis
Brite
KEGG Orthology (KO) [BR:pnr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AT302_05410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ALS59280
UniProt: A0A0U2W6X2
Position
complement(5571964..5572338)
Genome map
AA seq 124 aa AA seqDB search
MSQYEFTVTVRPQYLPEQSEPDRRQFAFAYTITIRNSGEVPAQLISRHWVITDGDNKVQE
VNGLGVVGHQPFLQPGEQFEYTSWAMVGTPVGTMRGEYFCVAEDGTRFEAPIAEFALTMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtatgaatttaccgtcacggtgcgcccgcaatacttgcccgagcagtcggaa
ccggatcgccggcaatttgcctttgcctacacgatcacgattcgcaacagcggggaagtg
cctgcgcaattgatctcgcgccattgggtcatcaccgacggcgacaacaaggtgcaggaa
gtcaacggcctgggcgtggtcgggcatcaaccgttcctgcaaccgggcgaacagttcgaa
tacacgagctgggccatggtcggcacgccggtcggcaccatgcgcggcgaatatttctgc
gtagccgaggacggcacgcgctttgaagcgccgatcgccgaatttgcgcttaccatgccg
cgcaccctgcattga

DBGET integrated database retrieval system